Recombinant Human SNX12 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SNX12-5648H |
Product Overview : | SNX12 MS Standard C13 and N15-labeled recombinant protein (NP_037478) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members. A similar protein in mouse may be involved in regulating the neurite outgrowth. Alternate splicing results in multiple transcript variants. |
Molecular Mass : | 18.9 kDa |
AA Sequence : | MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKVRQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SNX12 sorting nexin 12 [ Homo sapiens (human) ] |
Official Symbol | SNX12 |
Synonyms | SNX12; sorting nexin 12; sorting nexin-12; FLJ22128; MGC118982; MGC118983; |
Gene ID | 29934 |
mRNA Refseq | NM_013346 |
Protein Refseq | NP_037478 |
MIM | 300883 |
UniProt ID | Q9UMY4 |
◆ Recombinant Proteins | ||
SNX12-7396Z | Recombinant Zebrafish SNX12 | +Inquiry |
SNX12-11345Z | Recombinant Zebrafish SNX12 | +Inquiry |
Snx12-6022M | Recombinant Mouse Snx12 Protein, Myc/DDK-tagged | +Inquiry |
SNX12-3177C | Recombinant Chicken SNX12 | +Inquiry |
SNX12-4389R | Recombinant Rhesus monkey SNX12 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNX12-1601HCL | Recombinant Human SNX12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNX12 Products
Required fields are marked with *
My Review for All SNX12 Products
Required fields are marked with *
0
Inquiry Basket