Recombinant Human SNX12 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SNX12-5648H
Product Overview : SNX12 MS Standard C13 and N15-labeled recombinant protein (NP_037478) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members. A similar protein in mouse may be involved in regulating the neurite outgrowth. Alternate splicing results in multiple transcript variants.
Molecular Mass : 18.9 kDa
AA Sequence : MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKVRQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SNX12 sorting nexin 12 [ Homo sapiens (human) ]
Official Symbol SNX12
Synonyms SNX12; sorting nexin 12; sorting nexin-12; FLJ22128; MGC118982; MGC118983;
Gene ID 29934
mRNA Refseq NM_013346
Protein Refseq NP_037478
MIM 300883
UniProt ID Q9UMY4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SNX12 Products

Required fields are marked with *

My Review for All SNX12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon