Recombinant Human SNX12 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SNX12-5648H
• Product Overview: SNX12 MS Standard C13 and N15-labeled recombinant protein (NP_037478) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members. A similar protein in mouse may be involved in regulating the neurite outgrowth. Alternate splicing results in multiple transcript variants.
• Molecular Mass: 18.9 kDa
• AA Sequence: MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKVRQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SNX12 sorting nexin 12 [ Homo sapiens (human) ]
• Official Symbol: SNX12
• Synonyms: SNX12; sorting nexin 12; sorting nexin-12; FLJ22128; MGC118982; MGC118983
• Gene ID: 29934
• mRNA Refseq: NM_013346
• Protein Refseq: NP_037478
• MIM: 300883
• UniProt ID: Q9UMY4