Recombinant Human SNX20 protein, GST-tagged
Cat.No. : | SNX20-3512H |
Product Overview : | Recombinant Human SNX20 protein(Q7Z614)(1-102aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-102aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 38.4 kDa |
AA Sequence : | MASPEHPGSPGCMGPITQCTARTQQEAPATGPDLPHPGPDGHLDTHSGLSSNSSMTTRELQQYWQNQKCRWKHVKLLFEIASARIEERKVSKFVVYQIIVIQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SNX20 sorting nexin 20 [ Homo sapiens ] |
Official Symbol | SNX20 |
Synonyms | SNX20; sorting nexin 20; sorting nexin-20; selectin ligand interactor cytoplasmic 1; SLIC 1; SLIC1; selectin ligand interactor cytoplasmic-1; selectin ligand-interactor cytoplasmic 1; MGC35578; |
Gene ID | 124460 |
mRNA Refseq | NM_001144972 |
Protein Refseq | NP_001138444 |
MIM | 613281 |
UniProt ID | Q7Z614 |
◆ Recombinant Proteins | ||
SNX20-4210R | Recombinant Rhesus Macaque SNX20 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNX20-5315R | Recombinant Rat SNX20 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNX20-5656R | Recombinant Rat SNX20 Protein | +Inquiry |
Snx20-6028M | Recombinant Mouse Snx20 Protein, Myc/DDK-tagged | +Inquiry |
SNX20-2330H | Recombinant Human SNX20 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNX20-1640HCL | Recombinant Human SNX20 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SNX20 Products
Required fields are marked with *
My Review for All SNX20 Products
Required fields are marked with *
0
Inquiry Basket