Recombinant Human SNX27 protein, His-tagged
| Cat.No. : | SNX27-3216H |
| Product Overview : | Recombinant Human SNX27 protein(1-100 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-100 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MDSTTVNYFALFEVISHSFVRKLAPNEFPHKLYIQNYTSAVPGTCLTIRKWLFTTEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSYQLQKLYEQR |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SNX27 sorting nexin family member 27 [ Homo sapiens ] |
| Official Symbol | SNX27 |
| Synonyms | SNX27; sorting nexin family member 27; sorting nexin-27; KIAA0488; MGC20471; MY014; methamphetamine-responsive transcript 1; MRT1; MGC126871; MGC126873; |
| Gene ID | 81609 |
| mRNA Refseq | NM_030918 |
| Protein Refseq | NP_112180 |
| MIM | 611541 |
| UniProt ID | Q96L92 |
| ◆ Recombinant Proteins | ||
| Snx27-6029M | Recombinant Mouse Snx27 Protein, Myc/DDK-tagged | +Inquiry |
| SNX27-15728M | Recombinant Mouse SNX27 Protein | +Inquiry |
| SNX27-3969H | Recombinant Human SNX27 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SNX27-2324H | Recombinant Human SNX27 Protein, MYC/DDK-tagged | +Inquiry |
| SNX27-5658R | Recombinant Rat SNX27 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNX27 Products
Required fields are marked with *
My Review for All SNX27 Products
Required fields are marked with *
