Recombinant Human SOD1 protein, His-tagged

Cat.No. : SOD1-642H
Product Overview : Recombinant Human SOD1 protein, fused to His-tag at N-terminus, was expressed in Escherichia coli.
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 189
Description : Superoxide dismutase catalyzes the reaction between superoxide anions and hydrogen to yield molecular oxygen and hydrogen peroxide. Cu/Zn superoxide dismutase also named as SOD1, is an enzyme encoded by the SOD1 gene in humans, located on chromosome 21. The SOD1 binds Cu and Zn ions and is one of three SODs responsible for destroying free superoxide radicals in the body. It has been shown to interact with CCS and Bcl-2. The malfunction of SOD1 may increase the risk of illnesses like age-related muscle mass loss (sarcopenia), early development of cataracts, macular degeneration, thymic involution, hepatocellular carcinoma, shortened lifespan, keratoconus and amyotrophic lateral sclerosis.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The potency per mg was determined by Pyrogallic Acid method and was found to be more than 1.0 × 10⁴ IU/mg.
Molecular Mass : Approximately 39.9 kDa, a homodimer, non-glycosylated polypeptide chain containing 2 × 189 amino acids with Met, Gly and 10 × His at N-terminus.
AA Sequence : MGHHHHHHHHHHSSGHIEGRHMTYARAAARQARALEATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Endotoxin : Less than 1 EU/μg of rHuCu/Zn SOD, His as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name SOD1
Official Symbol SOD1
Synonyms SOD1; superoxide dismutase 1, soluble; ALS, ALS1, amyotrophic lateral sclerosis 1 (adult); superoxide dismutase [Cu-Zn]; IPOA; SOD, soluble; indophenoloxidase A; Cu/Zn superoxide dismutase; superoxide dismutase, cystolic; ALS; SOD; ALS1; hSod1; homodimer;
Gene ID 6647
mRNA Refseq NM_000454
Protein Refseq NP_000445
MIM 147450
UniProt ID P00441

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SOD1 Products

Required fields are marked with *

My Review for All SOD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon