Recombinant Human SORL1

Cat.No. : SORL1-29617TH
Product Overview : Recombinant fragment corresponding to amino acids 82-181 of Human SorLA with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a mosaic protein that belongs to at least two families: the vacuolar protein sorting 10 (VPS10) domain-containing receptor family, and the low density lipoprotein receptor (LDLR) family. The encoded protein also contains fibronectin type III repeats and an epidermal growth factor repeat. The encoded protein is translated as a preproprotein and likely plays roles in endocytosis and sorting. There may be an association between expression of this locus and Alzheimers Disease.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Expressed mainly in brain, where it is most abundant in the cerebellum, cerebral cortex and the occipital pole; low expression in the putamen and the thalamus. According to PubMed:9157966, found in spinal cord, testis, liver, kidney and pancreas with dete
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFAD
Sequence Similarities : Belongs to the SORL1 family.Contains 5 BNR repeats.Contains 1 EGF-like domain.Contains 6 fibronectin type-III domains.Contains 11 LDL-receptor class A domains.Contains 5 LDL-receptor class B repeats.
Gene Name SORL1 sortilin-related receptor, L(DLR class) A repeats containing [ Homo sapiens ]
Official Symbol SORL1
Synonyms SORL1; sortilin-related receptor, L(DLR class) A repeats containing; C11orf32, chromosome 11 open reading frame 32 , sortilin related receptor, L(DLR class) A repeats containing; sortilin-related receptor; gp250; LR11; LRP9; SorLA; SorLA 1;
Gene ID 6653
mRNA Refseq NM_003105
Protein Refseq NP_003096
MIM 602005
Uniprot ID Q92673
Chromosome Location 11q23.2-q24.4
Function low-density lipoprotein particle binding; receptor activity; transmembrane signaling receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SORL1 Products

Required fields are marked with *

My Review for All SORL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon