Species : |
Human |
Source : |
Wheat Germ |
Tag : |
Non |
Protein Length : |
100 amino acids |
Description : |
This gene encodes a mosaic protein that belongs to at least two families: the vacuolar protein sorting 10 (VPS10) domain-containing receptor family, and the low density lipoprotein receptor (LDLR) family. The encoded protein also contains fibronectin type III repeats and an epidermal growth factor repeat. The encoded protein is translated as a preproprotein and likely plays roles in endocytosis and sorting. There may be an association between expression of this locus and Alzheimers Disease. |
Molecular Weight : |
36.630kDa inclusive of tags |
Tissue specificity : |
Expressed mainly in brain, where it is most abundant in the cerebellum, cerebral cortex and the occipital pole; low expression in the putamen and the thalamus. According to PubMed:9157966, found in spinal cord, testis, liver, kidney and pancreas with dete |
Form : |
Liquid |
Purity : |
Proprietary Purification |
Storage buffer : |
pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : |
SAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFAD |
Sequence Similarities : |
Belongs to the SORL1 family.Contains 5 BNR repeats.Contains 1 EGF-like domain.Contains 6 fibronectin type-III domains.Contains 11 LDL-receptor class A domains.Contains 5 LDL-receptor class B repeats. |