Recombinant Human SOX10 Protein, Tag Free
Cat.No. : | SOX10-01H |
Product Overview : | Recombinant human SOX10 protein without tag was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. This protein acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease. |
Molecular Mass : | The protein has a calculated MW of 50 kDa. |
AA Sequence : | MAEEQDLSEVELSPVGSEEPRCLSPGSAPSLGPDGGGGGSGLRASPGPGELGKVKKEQQDGEADDDKFPVCIREAVSQVLSGYDWTLVPMPVRVNGASKSKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESDKRPFIEEAERLRMQHKKDHPDYKYQPRRRKNGKAAQGEAECPGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPTPPTTPKTELQSGKADPKRDGRSMGEGGKPHIDFGNVDIGEISHEVMSNMETFDVAELDQYLPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP |
Purity : | >80% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.29 mg/mL |
Storage Buffer : | PBS, pH7.4, 10% glycerol |
Gene Name | SOX10 SRY (sex determining region Y)-box 10 [ Homo sapiens (human) ] |
Official Symbol | SOX10 |
Synonyms | SOX10; SRY (sex determining region Y)-box 10; transcription factor SOX-10; DOM; dominant megacolon; mouse; human homolog of; WS2E; WS4; SRY-related HMG-box gene 10; dominant megacolon, mouse, human homolog of; PCWH; WS4C; MGC15649; |
Gene ID | 6663 |
mRNA Refseq | NM_006941 |
Protein Refseq | NP_008872 |
MIM | 602229 |
UniProt ID | P56693 |
◆ Recombinant Proteins | ||
SOX10-9379Z | Recombinant Zebrafish SOX10 | +Inquiry |
SOX10-2794H | Recombinant Human SOX10 protein(151-220 aa), C-His-tagged | +Inquiry |
SOX10-29273TH | Recombinant Human SOX10 | +Inquiry |
SOX10-8583M | Recombinant Mouse SOX10 Protein, His (Fc)-Avi-tagged | +Inquiry |
Sox10-6049M | Recombinant Mouse Sox10 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOX10-1565HCL | Recombinant Human SOX10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOX10 Products
Required fields are marked with *
My Review for All SOX10 Products
Required fields are marked with *