Recombinant Human SOX10

• Cat.No.: SOX10-29273TH
• Product Overview: Recombinant fragment of Human SOX10 with N terminal proprietary tag, 36.41kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 98 amino acids
• Description: This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. This protein acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.
• Molecular Weight: 36.410kDa inclusive of tags
• Tissue specificity: Expressed in fetal brain and in adult brain, heart, small intestine and colon.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQR
• Sequence Similarities: Contains 1 HMG box DNA-binding domain.

Gene Information

• Gene Name: SOX10 SRY (sex determining region Y)-box 10 [ Homo sapiens ]
• Official Symbol: SOX10
• Synonyms: SOX10; SRY (sex determining region Y)-box 10; transcription factor SOX-10; DOM; dominant megacolon; mouse; human homolog of; WS2E; WS4
• Gene ID: 6663
• mRNA Refseq: NM_006941
• Protein Refseq: NP_008872
• MIM: 602229
• Uniprot ID: P56693
• Chromosome Location: 22q13.1
• Function: DNA binding; chromatin binding; identical protein binding; protein binding; sequence-specific DNA binding transcription factor activity