Recombinant Human SOX10
Cat.No. : | SOX10-29273TH |
Product Overview : | Recombinant fragment of Human SOX10 with N terminal proprietary tag, 36.41kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 98 amino acids |
Description : | This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. This protein acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease. |
Molecular Weight : | 36.410kDa inclusive of tags |
Tissue specificity : | Expressed in fetal brain and in adult brain, heart, small intestine and colon. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQR |
Sequence Similarities : | Contains 1 HMG box DNA-binding domain. |
Gene Name | SOX10 SRY (sex determining region Y)-box 10 [ Homo sapiens ] |
Official Symbol | SOX10 |
Synonyms | SOX10; SRY (sex determining region Y)-box 10; transcription factor SOX-10; DOM; dominant megacolon; mouse; human homolog of; WS2E; WS4; |
Gene ID | 6663 |
mRNA Refseq | NM_006941 |
Protein Refseq | NP_008872 |
MIM | 602229 |
Uniprot ID | P56693 |
Chromosome Location | 22q13.1 |
Function | DNA binding; chromatin binding; identical protein binding; protein binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
SOX10-15772M | Recombinant Mouse SOX10 Protein | +Inquiry |
SOX10-5334R | Recombinant Rat SOX10 Protein, His (Fc)-Avi-tagged | +Inquiry |
SOX10-01H | Recombinant Human SOX10 Protein, Tag Free | +Inquiry |
SOX10-1001HF | Recombinant Full Length Human SOX10 Protein, GST-tagged | +Inquiry |
SOX10-9379Z | Recombinant Zebrafish SOX10 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOX10-1565HCL | Recombinant Human SOX10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOX10 Products
Required fields are marked with *
My Review for All SOX10 Products
Required fields are marked with *
0
Inquiry Basket