Recombinant Human SOX10

Cat.No. : SOX10-29273TH
Product Overview : Recombinant fragment of Human SOX10 with N terminal proprietary tag, 36.41kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 98 amino acids
Description : This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. This protein acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.
Molecular Weight : 36.410kDa inclusive of tags
Tissue specificity : Expressed in fetal brain and in adult brain, heart, small intestine and colon.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQR
Sequence Similarities : Contains 1 HMG box DNA-binding domain.
Gene Name SOX10 SRY (sex determining region Y)-box 10 [ Homo sapiens ]
Official Symbol SOX10
Synonyms SOX10; SRY (sex determining region Y)-box 10; transcription factor SOX-10; DOM; dominant megacolon; mouse; human homolog of; WS2E; WS4;
Gene ID 6663
mRNA Refseq NM_006941
Protein Refseq NP_008872
MIM 602229
Uniprot ID P56693
Chromosome Location 22q13.1
Function DNA binding; chromatin binding; identical protein binding; protein binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SOX10 Products

Required fields are marked with *

My Review for All SOX10 Products

Required fields are marked with *

0
cart-icon