Recombinant Human SOX17 protein, GST-tagged
| Cat.No. : | SOX17-301127H |
| Product Overview : | Recombinant Human SOX17 protein(1-66 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-66 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | MSSPDAGYASDDQSQTQSALPAVMAGLGPCPWAESLSPIGDMKVKGEAPANSGAPAGAAGRAKGES |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SOX17 SRY (sex determining region Y)-box 17 [ Homo sapiens ] |
| Official Symbol | SOX17 |
| Synonyms | SOX17; SRY (sex determining region Y)-box 17; transcription factor SOX-17; SRY-related HMG-box transcription factor SOX17; VUR3; FLJ22252; |
| Gene ID | 64321 |
| mRNA Refseq | NM_022454 |
| Protein Refseq | NP_071899 |
| MIM | 610928 |
| UniProt ID | Q9H6I2 |
| ◆ Recombinant Proteins | ||
| SOX17-301127H | Recombinant Human SOX17 protein, GST-tagged | +Inquiry |
| SOX17-8589M | Recombinant Mouse SOX17 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SOX17-1911HFL | Recombinant Full Length Human SOX17 Protein, C-Flag-tagged | +Inquiry |
| SOX17-3865H | Recombinant Human SOX17 protein, His-tagged | +Inquiry |
| SOX17-3381C | Recombinant Chicken SOX17 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SOX17-1562HCL | Recombinant Human SOX17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOX17 Products
Required fields are marked with *
My Review for All SOX17 Products
Required fields are marked with *
