Recombinant Human SP2

Cat.No. : SP2-31435TH
Product Overview : Recombinant fragment of Human SP2 transcription factor with N terminal proprietary tag; Predicted MW 35.64 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 91 amino acids
Description : This gene encodes a member of the Sp subfamily of Sp/XKLF transcription factors. Sp family proteins are sequence-specific DNA-binding proteins characterized by an amino-terminal trans-activation domain and three carboxy-terminal zinc finger motifs. This protein contains the least conserved DNA-binding domain within the Sp subfamily of proteins, and its DNA sequence specificity differs from the other Sp proteins. It localizes primarily within subnuclear foci associated with the nuclear matrix, and can activate or in some cases repress expression from different promoters.
Molecular Weight : 35.640kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SPGKNSFGILSSKGNILQIQGSQLSASYPGGQLVFAIQNPTMINKGTRSNANIQYQAVPQIQASNSQTIQVQPNLTNQIQIIPGTNQAIIT
Sequence Similarities : Belongs to the Sp1 C2H2-type zinc-finger protein family.Contains 3 C2H2-type zinc fingers.
Gene Name SP2 Sp2 transcription factor [ Homo sapiens ]
Official Symbol SP2
Synonyms SP2; Sp2 transcription factor; transcription factor Sp2; KIAA0048;
Gene ID 6668
mRNA Refseq NM_003110
Protein Refseq NP_003101
MIM 601801
Uniprot ID Q02086
Chromosome Location 17q21.3-q22
Function DNA binding; histone deacetylase binding; metal ion binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SP2 Products

Required fields are marked with *

My Review for All SP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon