Recombinant Human SP2
| Cat.No. : | SP2-31435TH |
| Product Overview : | Recombinant fragment of Human SP2 transcription factor with N terminal proprietary tag; Predicted MW 35.64 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 91 amino acids |
| Description : | This gene encodes a member of the Sp subfamily of Sp/XKLF transcription factors. Sp family proteins are sequence-specific DNA-binding proteins characterized by an amino-terminal trans-activation domain and three carboxy-terminal zinc finger motifs. This protein contains the least conserved DNA-binding domain within the Sp subfamily of proteins, and its DNA sequence specificity differs from the other Sp proteins. It localizes primarily within subnuclear foci associated with the nuclear matrix, and can activate or in some cases repress expression from different promoters. |
| Molecular Weight : | 35.640kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | SPGKNSFGILSSKGNILQIQGSQLSASYPGGQLVFAIQNPTMINKGTRSNANIQYQAVPQIQASNSQTIQVQPNLTNQIQIIPGTNQAIIT |
| Sequence Similarities : | Belongs to the Sp1 C2H2-type zinc-finger protein family.Contains 3 C2H2-type zinc fingers. |
| Gene Name | SP2 Sp2 transcription factor [ Homo sapiens ] |
| Official Symbol | SP2 |
| Synonyms | SP2; Sp2 transcription factor; transcription factor Sp2; KIAA0048; |
| Gene ID | 6668 |
| mRNA Refseq | NM_003110 |
| Protein Refseq | NP_003101 |
| MIM | 601801 |
| Uniprot ID | Q02086 |
| Chromosome Location | 17q21.3-q22 |
| Function | DNA binding; histone deacetylase binding; metal ion binding; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| SP2-489HF | Recombinant Full Length Human SP2 Protein | +Inquiry |
| SP2-8596M | Recombinant Mouse SP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SP2-4234R | Recombinant Rhesus Macaque SP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SP2-5794Z | Recombinant Zebrafish SP2 | +Inquiry |
| SP2-15793M | Recombinant Mouse SP2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SP2-1676HCL | Recombinant Human SP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SP2 Products
Required fields are marked with *
My Review for All SP2 Products
Required fields are marked with *
