Recombinant Human SP3

Cat.No. : SP3-31436TH
Product Overview : Recombinant fragment of Human SP3 with N-terminal proprietary tag.Mol Wt 36.63 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene belongs to a family of Sp1 related genes that encode transcription factors that regulate transcription by binding to consensus GC- and GT-box regulatory elements in target genes. This protein contains a zinc finger DNA-binding domain and several transactivation domains, and has been reported to function as a bifunctional transcription factor that either stimulates or represses the transcription of numerous genes. Transcript variants encoding different isoforms have been described for this gene, and one has been reported to initiate translation from a non-AUG (AUA) start codon. Additional isoforms, resulting from the use of alternate downstream translation initiation sites, have also been noted. A related pseudogene has been identified on chromosome 13.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Ubiquitously expressed.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQHQEGKRLRRVACTCPNCKEGGGRGTNL
Sequence Similarities : Belongs to the Sp1 C2H2-type zinc-finger protein family.Contains 3 C2H2-type zinc fingers.
Gene Name SP3 Sp3 transcription factor [ Homo sapiens ]
Official Symbol SP3
Synonyms SP3; Sp3 transcription factor; transcription factor Sp3; SPR 2;
Gene ID 6670
mRNA Refseq NM_001017371
Protein Refseq NP_001017371
MIM 601804
Uniprot ID Q02447
Chromosome Location 2q31
Pathway Regulation of Telomerase, organism-specific biosystem; Selenium Metabolism and Selenoproteins, organism-specific biosystem;
Function DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; chromatin binding; double-stranded DNA binding; metal ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SP3 Products

Required fields are marked with *

My Review for All SP3 Products

Required fields are marked with *

0
cart-icon