Recombinant Human SP3 protein, GST-tagged
Cat.No. : | SP3-301162H |
Product Overview : | Recombinant Human SP3 (512-590 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ile412-Gln590 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | IVQGITPQTIHGVQASGQNISQQALQNLQLQLNPGTFLIQAQTVTPSGQVTWQTFQVQGVQNLQNLQIQNTAAQQITLTPVQTLTLGQVAAGGAFTSTPVSLSTGQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQHQ |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | SP3 Sp3 transcription factor [ Homo sapiens ] |
Official Symbol | SP3 |
Synonyms | SP3; Sp3 transcription factor; transcription factor Sp3; SPR 2; specificity protein 3; GC-binding transcription factor Sp3; SPR2; DKFZp686O1631; |
Gene ID | 6670 |
mRNA Refseq | NM_001017371 |
Protein Refseq | NP_001017371 |
MIM | 601804 |
UniProt ID | Q02447 |
◆ Recombinant Proteins | ||
SP3-15794M | Recombinant Mouse SP3 Protein | +Inquiry |
SP3-647HF | Recombinant Full Length Human SP3 Protein, GST-tagged | +Inquiry |
SP3-903H | Recombinant Human SP3 protein, GST-tagged | +Inquiry |
SP3-301162H | Recombinant Human SP3 protein, GST-tagged | +Inquiry |
SP3-2094H | Active Recombinant Human Sp3 Transcription Factor, FLAG-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SP3 Products
Required fields are marked with *
My Review for All SP3 Products
Required fields are marked with *