Recombinant Human SP3 protein, GST-tagged

• Cat.No.: SP3-301162H
• Product Overview: Recombinant Human SP3 (512-590 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Ile412-Gln590
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: IVQGITPQTIHGVQASGQNISQQALQNLQLQLNPGTFLIQAQTVTPSGQVTWQTFQVQGVQNLQNLQIQNTAAQQITLTPVQTLTLGQVAAGGAFTSTPVSLSTGQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQHQ
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: SP3 Sp3 transcription factor [ Homo sapiens ]
• Official Symbol: SP3
• Synonyms: SP3; Sp3 transcription factor; transcription factor Sp3; SPR 2; specificity protein 3; GC-binding transcription factor Sp3; SPR2; DKFZp686O1631
• Gene ID: 6670
• mRNA Refseq: NM_001017371
• Protein Refseq: NP_001017371
• MIM: 601804
• UniProt ID: Q02447