Recombinant Human SPC24 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SPC24-5620H
Product Overview : SPC24 MS Standard C13 and N15-labeled recombinant protein (NP_872319) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : SPC24 (SPC24 Component Of NDC80 Kinetochore Complex) is a Protein Coding gene. Among its related pathways are Signaling by GPCR and Mitotic Prometaphase.
Molecular Mass : 22.4 kDa
AA Sequence : MAAFRDIEEVSQGLLSLLGANRAEAQQRRLLGRHEQVVERLLETQDGAEKQLREILTMEKEVAQSLLNAKEQVHQGGVELQQLEAGLQEAGEEDTRLKASLLQLTRELEELKEIEADLERQEKEVDEDTTVTIPSAVYVAQLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLVDTEWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SPC24 SPC24 component of NDC80 kinetochore complex [ Homo sapiens (human) ]
Official Symbol SPC24
Synonyms SPC24; SPC24 component of NDC80 kinetochore complex; SPBC24; kinetochore protein Spc24; SPC24, NDC80 kinetochore complex component, homolog; hSpc24; spindle pole body component 24 homolog
Gene ID 147841
mRNA Refseq NM_182513
Protein Refseq NP_872319
MIM 609394
UniProt ID Q8NBT2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPC24 Products

Required fields are marked with *

My Review for All SPC24 Products

Required fields are marked with *

0
cart-icon