Recombinant Human SPC24 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SPC24-5620H |
Product Overview : | SPC24 MS Standard C13 and N15-labeled recombinant protein (NP_872319) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | SPC24 (SPC24 Component Of NDC80 Kinetochore Complex) is a Protein Coding gene. Among its related pathways are Signaling by GPCR and Mitotic Prometaphase. |
Molecular Mass : | 22.4 kDa |
AA Sequence : | MAAFRDIEEVSQGLLSLLGANRAEAQQRRLLGRHEQVVERLLETQDGAEKQLREILTMEKEVAQSLLNAKEQVHQGGVELQQLEAGLQEAGEEDTRLKASLLQLTRELEELKEIEADLERQEKEVDEDTTVTIPSAVYVAQLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLVDTEWTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SPC24 SPC24 component of NDC80 kinetochore complex [ Homo sapiens (human) ] |
Official Symbol | SPC24 |
Synonyms | SPC24; SPC24 component of NDC80 kinetochore complex; SPBC24; kinetochore protein Spc24; SPC24, NDC80 kinetochore complex component, homolog; hSpc24; spindle pole body component 24 homolog |
Gene ID | 147841 |
mRNA Refseq | NM_182513 |
Protein Refseq | NP_872319 |
MIM | 609394 |
UniProt ID | Q8NBT2 |
◆ Recombinant Proteins | ||
SPC24-8629M | Recombinant Mouse SPC24 Protein, His (Fc)-Avi-tagged | +Inquiry |
SPC24-3038Z | Recombinant Zebrafish SPC24 | +Inquiry |
SPC24-3234H | Recombinant Human SPC24 protein, His-tagged | +Inquiry |
SPC24-5620H | Recombinant Human SPC24 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SPC24-4244R | Recombinant Rhesus Macaque SPC24 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPC24-1528HCL | Recombinant Human SPC24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPC24 Products
Required fields are marked with *
My Review for All SPC24 Products
Required fields are marked with *
0
Inquiry Basket