Recombinant Human SPCS1 protein, His-tagged
Cat.No. : | SPCS1-4005H |
Product Overview : | Recombinant Human SPCS1 protein(1 - 102 aa), fused to His tag, was expressed in E. coli. |
Availability | October 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1 - 102 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLAQLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKRHAK |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SPCS1 signal peptidase complex subunit 1 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | SPCS1 |
Synonyms | SPCS1; signal peptidase complex subunit 1 homolog (S. cerevisiae); signal peptidase complex subunit 1; HSPC033; SPC1; SPC12; YJR010C A; SPase 12 kDa subunit; signal peptidase 12kDa; microsomal signal peptidase 12 kDa subunit; YJR010C-A; |
Gene ID | 28972 |
mRNA Refseq | NM_014041 |
Protein Refseq | NP_054760 |
MIM | 610358 |
UniProt ID | Q9Y6A9 |
◆ Recombinant Proteins | ||
RFL8324BF | Recombinant Full Length Bovine Signal Peptidase Complex Subunit 1(Spcs1) Protein, His-Tagged | +Inquiry |
SPCS1-6268H | Recombinant Human SPCS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Spcs1-6085M | Recombinant Mouse Spcs1 Protein, Myc/DDK-tagged | +Inquiry |
SPCS1-4055C | Recombinant Chicken SPCS1 | +Inquiry |
SPCS1-15852M | Recombinant Mouse SPCS1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPCS1-1526HCL | Recombinant Human SPCS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPCS1 Products
Required fields are marked with *
My Review for All SPCS1 Products
Required fields are marked with *