Recombinant Human SPEF2 Protein, GST-tagged

Cat.No. : SPEF2-4288H
Product Overview : Human FLJ23577 partial ORF ( NP_079143, 324 a.a. - 422 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : SPEF2 (Sperm Flagellar 2) is a Protein Coding gene. GO annotations related to this gene include protein dimerization activity.
Molecular Mass : 36.63 kDa
AA Sequence : AQEEAYREEQLINRLMRQSQQERRIAVQLMHVRHEKEVLWQNRIFREKQHEERRLKDFQDALDREAALAKQAKIDFEEQFLKEKRFHDQIAVERAQARY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SPEF2 sperm flagellar 2 [ Homo sapiens ]
Official Symbol SPEF2
Synonyms SPEF2; sperm flagellar 2; sperm flagellar protein 2; cancer/testis antigen 122; CT122; FLJ23577; KPL2; FLJ23164; FLJ25395; KIAA1770; MGC102842;
Gene ID 79925
mRNA Refseq NM_024867
Protein Refseq NP_079143
MIM 610172
UniProt ID Q9C093

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPEF2 Products

Required fields are marked with *

My Review for All SPEF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon