Recombinant Human SPN protein(281-360 aa), C-His-tagged
Cat.No. : | SPN-2663H |
Product Overview : | Recombinant Human SPN protein(P16150)(281-360 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 281-360 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | QKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEE |
Gene Name | SPN sialophorin [ Homo sapiens ] |
Official Symbol | SPN |
Synonyms | SPN; sialophorin; sialophorin (gpL115, leukosialin, CD43); leukosialin; CD43; GPL115; LSN; GALGP; galactoglycoprotein; leukocyte sialoglycoprotein; sialophorin (leukosialin, CD43); |
Gene ID | 6693 |
mRNA Refseq | NM_001030288 |
Protein Refseq | NP_001025459 |
MIM | 182160 |
UniProt ID | P16150 |
◆ Recombinant Proteins | ||
Spn-7035MF | Recombinant Mouse Spn Protein, Fc-tagged, FITC conjugated | +Inquiry |
Spn-7035MAF555 | Recombinant Mouse Spn Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
SPN-3246H | Recombinant Human SPN Protein, His-tagged | +Inquiry |
Spn-7035M | Recombinant Mouse Spn protein(Met1-Gly248), hFc-tagged | +Inquiry |
Spn-2094M | Recombinant Mouse Spn Protein, His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPN-893RCL | Recombinant Rat SPN cell lysate | +Inquiry |
SPN-1739MCL | Recombinant Mouse SPN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPN Products
Required fields are marked with *
My Review for All SPN Products
Required fields are marked with *