Recombinant Human SPN protein(281-360 aa), C-His-tagged
| Cat.No. : | SPN-2663H |
| Product Overview : | Recombinant Human SPN protein(P16150)(281-360 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 281-360 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | QKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEE |
| Gene Name | SPN sialophorin [ Homo sapiens ] |
| Official Symbol | SPN |
| Synonyms | SPN; sialophorin; sialophorin (gpL115, leukosialin, CD43); leukosialin; CD43; GPL115; LSN; GALGP; galactoglycoprotein; leukocyte sialoglycoprotein; sialophorin (leukosialin, CD43); |
| Gene ID | 6693 |
| mRNA Refseq | NM_001030288 |
| Protein Refseq | NP_001025459 |
| MIM | 182160 |
| UniProt ID | P16150 |
| ◆ Recombinant Proteins | ||
| Spn-7035MF | Recombinant Mouse Spn Protein, Fc-tagged, FITC conjugated | +Inquiry |
| Spn-6102M | Recombinant Mouse Spn Protein, Myc/DDK-tagged | +Inquiry |
| Spn-7035MAF647 | Recombinant Mouse Spn Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| SPN-5117H | Recombinant Human SPN Protein (Met1-Arg253), C-His tagged | +Inquiry |
| Spn-7035M | Recombinant Mouse Spn protein(Met1-Gly248), hFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SPN-893RCL | Recombinant Rat SPN cell lysate | +Inquiry |
| SPN-1739MCL | Recombinant Mouse SPN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPN Products
Required fields are marked with *
My Review for All SPN Products
Required fields are marked with *
