Recombinant Human SPP1 protein(231-300 aa), C-His-tagged
| Cat.No. : | SPP1-2628H |
| Product Overview : | Recombinant Human SPP1 protein(P10451)(231-300 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 231-300 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 11 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | DDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKF |
| Gene Name | SPP1 secreted phosphoprotein 1 [ Homo sapiens ] |
| Official Symbol | SPP1 |
| Synonyms | SPP1; secreted phosphoprotein 1; BNSP, bone sialoprotein I , OPN, osteopontin; osteopontin; BSPI; early T lymphocyte activation 1; ETA 1; uropontin; nephropontin; osteopontin-C; osteopontin-D; SPP1/CALPHA1 fusion; bone sialoprotein 1; urinary stone protein; early T-lymphocyte activation 1; osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein; secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1); OPN; BNSP; ETA-1; MGC110940; |
| Gene ID | 6696 |
| mRNA Refseq | NM_000582 |
| Protein Refseq | NP_000573 |
| MIM | 166490 |
| UniProt ID | P10451 |
| ◆ Recombinant Proteins | ||
| SPP1-465M | Recombinant Mouse SPP1 protein, His-tagged | +Inquiry |
| SPP1-2089H | Recombinant Human SPP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SPP1-1164P | Recombinant Pig SPP1 Protein, His-tagged | +Inquiry |
| SPP1-3044H | Recombinant Human SPP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SPP1-372H | Recombinant Human Secreted Phosphoprotein 1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SPP1-2535HCL | Recombinant Human SPP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPP1 Products
Required fields are marked with *
My Review for All SPP1 Products
Required fields are marked with *
