Recombinant Human SPRED1 protein, His-SUMO & Myc-tagged
Cat.No. : | SPRED1-4593H |
Product Overview : | Recombinant Human SPRED1 protein(Q7Z699)(2-444aa), fused to N-terminal His-SUMO tag and C-terminal Myc tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 2-444aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 70.3 kDa |
AA Sequence : | SEETATSDNDNSYARVRAVVMTRDDSSGGWLPLGGSGLSSVTVFKVPHQEENGCADFFIRGERLRDKMVVLECMLKKDLIYNKVTPTFHHWKIDDKKFGLTFQSPADARAFDRGIRRAIEDISQGCPESKNEAEGADDLQANEEDSSSSLVKDHLFQQETVVTSEPYRSSNIRPSPFEDLNARRVYMQSQANQITFGQPGLDIQSRSMEYVQRQISKECGSLKSQNRVPLKSIRHVSFQDEDEIVRINPRDILIRRYADYRHPDMWKNDLERDDADSSIQFSKPDSKKSDYLYSCGDETKLSSPKDSVVFKTQPSSLKIKKSKRRKEDGERSRCVYCQERFNHEENVRGKCQDAPDPIKRCIYQVSCMLCAESMLYHCMSDSEGDFSDPCSCDTSDDKFCLRWLALVALSFIVPCMCCYVPLRMCHRCGEACGCCGGKHKAAG |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SPRED1 sprouty-related, EVH1 domain containing 1 [ Homo sapiens ] |
Official Symbol | SPRED1 |
Synonyms | SPRED1; sprouty-related, EVH1 domain containing 1; sprouty-related, EVH1 domain-containing protein 1; FLJ33903; hSpred1; spred-1; suppressor of Ras/MAPK activation; EVH1/Sprouty domain containing protein; NFLS; |
Gene ID | 161742 |
mRNA Refseq | NM_152594 |
Protein Refseq | NP_689807 |
MIM | 609291 |
UniProt ID | Q7Z699 |
◆ Recombinant Proteins | ||
SPRED1-15925M | Recombinant Mouse SPRED1 Protein | +Inquiry |
SPRED1-4593H | Recombinant Human SPRED1 protein, His-SUMO & Myc-tagged | +Inquiry |
SPRED1-12434Z | Recombinant Zebrafish SPRED1 | +Inquiry |
SPRED1-4465C | Recombinant Chicken SPRED1 | +Inquiry |
SPRED1-8674M | Recombinant Mouse SPRED1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPRED1-1498HCL | Recombinant Human SPRED1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPRED1 Products
Required fields are marked with *
My Review for All SPRED1 Products
Required fields are marked with *