Recombinant Human SPRR2E Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SPRR2E-5310H |
Product Overview : | SPRR2E MS Standard C13 and N15-labeled recombinant protein (NP_001019380) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of a family of small proline-rich proteins clustered in the epidermal differentiation complex on chromosome 1q21. The encoded protein, along with other family members, is a component of the cornified cell envelope that forms beneath the plasma membrane in terminally differentiated stratified squamous epithelia. This envelope serves as a barrier against extracellular and environmental factors. The seven SPRR2 genes (A-G) appear to have been homogenized by gene conversion compared to others in the cluster that exhibit greater differences in protein structure. |
Molecular Mass : | 7.7 kDa |
AA Sequence : | MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKCPPVTPSPPCQPKCPPKSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SPRR2E small proline rich protein 2E [ Homo sapiens (human) ] |
Official Symbol | SPRR2E |
Synonyms | SPRR2E; small proline rich protein 2E; small proline-rich protein 2E; SPR-2E; SPR-II; small proline-rich protein II |
Gene ID | 6704 |
mRNA Refseq | NM_001024209 |
Protein Refseq | NP_001019380 |
MIM | 617588 |
UniProt ID | P22531 |
◆ Recombinant Proteins | ||
SPRR2E-2935H | Recombinant Human SPRR2E, GST-tagged | +Inquiry |
Sprr2e-5325M | Recombinant Mouse Sprr2e protein, His-SUMO-tagged | +Inquiry |
SPRR2E-15935M | Recombinant Mouse SPRR2E Protein | +Inquiry |
SPRR2E-5310H | Recombinant Human SPRR2E Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SPRR2E-8683M | Recombinant Mouse SPRR2E Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPRR2E Products
Required fields are marked with *
My Review for All SPRR2E Products
Required fields are marked with *
0
Inquiry Basket