Recombinant Human SPRR2E Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SPRR2E-5310H
Product Overview : SPRR2E MS Standard C13 and N15-labeled recombinant protein (NP_001019380) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of a family of small proline-rich proteins clustered in the epidermal differentiation complex on chromosome 1q21. The encoded protein, along with other family members, is a component of the cornified cell envelope that forms beneath the plasma membrane in terminally differentiated stratified squamous epithelia. This envelope serves as a barrier against extracellular and environmental factors. The seven SPRR2 genes (A-G) appear to have been homogenized by gene conversion compared to others in the cluster that exhibit greater differences in protein structure.
Molecular Mass : 7.7 kDa
AA Sequence : MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKCPPVTPSPPCQPKCPPKSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SPRR2E small proline rich protein 2E [ Homo sapiens (human) ]
Official Symbol SPRR2E
Synonyms SPRR2E; small proline rich protein 2E; small proline-rich protein 2E; SPR-2E; SPR-II; small proline-rich protein II
Gene ID 6704
mRNA Refseq NM_001024209
Protein Refseq NP_001019380
MIM 617588
UniProt ID P22531

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPRR2E Products

Required fields are marked with *

My Review for All SPRR2E Products

Required fields are marked with *

0
cart-icon
0
compare icon