Recombinant Mouse Sprr2e protein, His-SUMO-tagged
Cat.No. : | Sprr2e-5325M |
Product Overview : | Recombinant Mouse Sprr2e protein(O70556)(1-76aa), fused with N-terminal His and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-76a.a. |
Tag : | His&SUMO |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 21.4 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MSYQQQQCKQPCQPPPVCPPKKCPEPCPHPQCPEPCPPPKCPEPCPEPCPPPSYQQKCPPVQPPPPCQQKCPPKSK |
◆ Recombinant Proteins | ||
Sprr2e-5325M | Recombinant Mouse Sprr2e protein, His-SUMO-tagged | +Inquiry |
SPRR2E-2935H | Recombinant Human SPRR2E, GST-tagged | +Inquiry |
SPRR2E-15935M | Recombinant Mouse SPRR2E Protein | +Inquiry |
SPRR2E-8683M | Recombinant Mouse SPRR2E Protein, His (Fc)-Avi-tagged | +Inquiry |
SPRR2E-5310H | Recombinant Human SPRR2E Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Sprr2e Products
Required fields are marked with *
My Review for All Sprr2e Products
Required fields are marked with *
0
Inquiry Basket