Recombinant Human SPRR3 protein, His-SUMO-tagged

• Cat.No.: SPRR3-3523H
• Product Overview: Recombinant Human SPRR3 protein(Q9UBC9)(2-169aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 2-169aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 34 kDa
• AA Sequence: SSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: SPRR3 small proline-rich protein 3 [ Homo sapiens ]
• Official Symbol: SPRR3
• Synonyms: SPRR3; small proline-rich protein 3; esophagin; cornifin beta; 22 kDa pancornulin
• Gene ID: 6707
• mRNA Refseq: NM_001097589
• Protein Refseq: NP_001091058
• MIM: 182271
• UniProt ID: Q9UBC9