Recombinant Human SPRR3 protein, His-SUMO-tagged
Cat.No. : | SPRR3-3523H |
Product Overview : | Recombinant Human SPRR3 protein(Q9UBC9)(2-169aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-169aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34 kDa |
AA Sequence : | SSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SPRR3 small proline-rich protein 3 [ Homo sapiens ] |
Official Symbol | SPRR3 |
Synonyms | SPRR3; small proline-rich protein 3; esophagin; cornifin beta; 22 kDa pancornulin; |
Gene ID | 6707 |
mRNA Refseq | NM_001097589 |
Protein Refseq | NP_001091058 |
MIM | 182271 |
UniProt ID | Q9UBC9 |
◆ Recombinant Proteins | ||
SPRR3-2937H | Recombinant Human SPRR3, GST-tagged | +Inquiry |
SPRR3-29265TH | Recombinant Human SPRR3 | +Inquiry |
SPRR3-2730H | Recombinant Human SPRR3 Protein, His-tagged | +Inquiry |
SPRR3-15940M | Recombinant Mouse SPRR3 Protein | +Inquiry |
SPRR3-8687M | Recombinant Mouse SPRR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPRR3-1493HCL | Recombinant Human SPRR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPRR3 Products
Required fields are marked with *
My Review for All SPRR3 Products
Required fields are marked with *