Recombinant Human SPRYD7 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SPRYD7-6167H
Product Overview : C13orf1 MS Standard C13 and N15-labeled recombinant protein (NP_065189) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : SPRYD7 (SPRY Domain Containing 7) is a Protein Coding gene.
Molecular Mass : 21.5 kDa
AA Sequence : MATSVLCCLRCCRDGGTGHIPLKEMPAVQLDTQHMGTDVVIVKNGRRICGTGGCLASAPLHQNKSYFEFKIQSTGIWGIGVATQKVNLNQIPLGRDMHSLVMRNDGALYHNNEEKNRLPANSLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYVDDSAILDCQFSEFYHTPPPGFEKILFEQQIFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SPRYD7 SPRY domain containing 7 [ Homo sapiens (human) ]
Official Symbol SPRYD7
Synonyms SPRYD7; SPRY domain containing 7; C13orf1, chromosome 13 open reading frame 1; SPRY domain-containing protein 7; CLLD6; CLL deletion region gene 6 protein; chronic lymphocytic leukemia deletion region gene 6 protein; C13orf1;
Gene ID 57213
mRNA Refseq NM_020456
Protein Refseq NP_065189
MIM 607866
UniProt ID Q5W111

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPRYD7 Products

Required fields are marked with *

My Review for All SPRYD7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon