Recombinant Human SPRYD7 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SPRYD7-6167H
• Product Overview: C13orf1 MS Standard C13 and N15-labeled recombinant protein (NP_065189) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: SPRYD7 (SPRY Domain Containing 7) is a Protein Coding gene.
• Molecular Mass: 21.5 kDa
• AA Sequence: MATSVLCCLRCCRDGGTGHIPLKEMPAVQLDTQHMGTDVVIVKNGRRICGTGGCLASAPLHQNKSYFEFKIQSTGIWGIGVATQKVNLNQIPLGRDMHSLVMRNDGALYHNNEEKNRLPANSLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYVDDSAILDCQFSEFYHTPPPGFEKILFEQQIFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SPRYD7 SPRY domain containing 7 [ Homo sapiens (human) ]
• Official Symbol: SPRYD7
• Synonyms: SPRYD7; SPRY domain containing 7; C13orf1, chromosome 13 open reading frame 1; SPRY domain-containing protein 7; CLLD6; CLL deletion region gene 6 protein; chronic lymphocytic leukemia deletion region gene 6 protein; C13orf1
• Gene ID: 57213
• mRNA Refseq: NM_020456
• Protein Refseq: NP_065189
• MIM: 607866
• UniProt ID: Q5W111