Recombinant Human SPTA1 protein, His-tagged
Cat.No. : | SPTA1-4572H |
Product Overview : | Recombinant Human SPTA1 protein(P02549)(53-474aa), fused to N-terminal His tag, was expressed in Mammalian cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | His |
Protein Length : | 53-474aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 52.9 kDa |
AA Sequence : | YHLQVFKRDADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEELRHLWDLLLELTLEKGDQLLRALKFQQYVQECADILEWIGDKEAIATSVELGEDWERTEVLHKKFEDFQVELVAKEGRVVEVNQYANECAEENHPDLPLIQSKQNEVNAAWERLRGLALQRQKALSNAANLQRFKRDVTEAIQWIKEKEPVLTSEDYGKDLVASEGLFHSHKGLERNLAVMSDKVKELCAKAEKLTLSHPSDAPQIQEMKEDLVSSWEHIRALATSRYEKLQATYWYHRFSSDFDELSGWMNEKTAAINADELPTDVAGGEVLLDRHQQHKHEIDSYDDRFQSADETGQDLVNANHEASDEVREKMEILDNNWTALLELWDERHRQYEQ |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | SPTA1 spectrin, alpha, erythrocytic 1 (elliptocytosis 2) [ Homo sapiens ] |
Official Symbol | SPTA1 |
Synonyms | SPTA1; spectrin, alpha, erythrocytic 1 (elliptocytosis 2); spectrin alpha chain, erythrocyte; EL2; alpha-I spectrin; erythroid alpha-spectrin; HPP; HS3; SPH3; SPTA; |
Gene ID | 6708 |
mRNA Refseq | NM_003126 |
Protein Refseq | NP_003117 |
MIM | 182860 |
UniProt ID | P02549 |
◆ Recombinant Proteins | ||
SPTA1-4571H | Recombinant Human SPTA1 protein, His-tagged | +Inquiry |
SPTA1-1389H | Recombinant Human SPTA1, GST-tagged | +Inquiry |
SPTA1-4572H | Recombinant Human SPTA1 protein, His-tagged | +Inquiry |
SPTA1-114H | Recombinant Human SPTA1 Protein, GST-tagged | +Inquiry |
SPTA1-532H | Recombinant Human SPTA1 protein(53-474aa), His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPTA1 Products
Required fields are marked with *
My Review for All SPTA1 Products
Required fields are marked with *
0
Inquiry Basket