Recombinant Human src kinase associated phosphoprotein 1 protein, His tagged
| Cat.No. : | SKAP1-01H |
| Product Overview : | Recombinant Human SKAP1 protein (1-358aa) with His tag was expressed in E. coli. |
| Availability | January 15, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-358aa |
| Description : | This gene encodes a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins. |
| Tag : | C-His |
| Molecular Mass : | 42 kDa |
| AA Sequence : | MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFLSDYQDEGMEDIVKGAQELDNVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLFYYYANEKSKQPKGTFLIKGYGVRMAPHLRRDSKKESCFELTSQDRRSYEFTATSPAEARDWVDQISFLLKDLSSLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSLVGIVPKEYLTTAFEVEERHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4 |
| Concentration : | 1 mg/mL by BCA |
| Gene Name | SKAP1 src kinase associated phosphoprotein 1 [ Homo sapiens (human) ] |
| Official Symbol | SKAP1 |
| Synonyms | SKAP1; src kinase associated phosphoprotein 1; SCAP1, src family associated phosphoprotein 1; src kinase-associated phosphoprotein 1; SKAP55; pp55; SKAP-55; src family associated phosphoprotein 1; src family-associated phosphoprotein 1; src kinase-associated phosphoprotein of 55 kDa; SCAP1 |
| Gene ID | 8631 |
| mRNA Refseq | NM_001075099 |
| Protein Refseq | NP_001068567 |
| MIM | 604969 |
| UniProt ID | Q86WV1 |
| ◆ Recombinant Proteins | ||
| SKAP1-5414R | Recombinant Rat SKAP1 Protein | +Inquiry |
| Skap1-8109R | Recombinant Rat Skap1 protein, His & T7-tagged | +Inquiry |
| Skap1-8108M | Recombinant Mouse Skap1 protein, His & T7-tagged | +Inquiry |
| SKAP1-01H | Recombinant Human src kinase associated phosphoprotein 1 protein, His tagged | +Inquiry |
| SKAP1-4587H | Recombinant Human SKAP1 protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SKAP1-1818HCL | Recombinant Human SKAP1 293 Cell Lysate | +Inquiry |
| SKAP1-1817HCL | Recombinant Human SKAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SKAP1 Products
Required fields are marked with *
My Review for All SKAP1 Products
Required fields are marked with *
