Recombinant Human src kinase associated phosphoprotein 1 protein, His tagged
Cat.No. : | SKAP1-01H |
Product Overview : | Recombinant Human SKAP1 protein (1-358aa) with His tag was expressed in E. coli. |
Availability | August 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-358aa |
Description : | This gene encodes a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins. |
Tag : | C-His |
Molecular Mass : | 42 kDa |
AA Sequence : | MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFLSDYQDEGMEDIVKGAQELDNVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLFYYYANEKSKQPKGTFLIKGYGVRMAPHLRRDSKKESCFELTSQDRRSYEFTATSPAEARDWVDQISFLLKDLSSLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSLVGIVPKEYLTTAFEVEERHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4 |
Concentration : | 1 mg/mL by BCA |
Gene Name | SKAP1 src kinase associated phosphoprotein 1 [ Homo sapiens (human) ] |
Official Symbol | SKAP1 |
Synonyms | SKAP1; src kinase associated phosphoprotein 1; SCAP1, src family associated phosphoprotein 1; src kinase-associated phosphoprotein 1; SKAP55; pp55; SKAP-55; src family associated phosphoprotein 1; src family-associated phosphoprotein 1; src kinase-associated phosphoprotein of 55 kDa; SCAP1 |
Gene ID | 8631 |
mRNA Refseq | NM_001075099 |
Protein Refseq | NP_001068567 |
MIM | 604969 |
UniProt ID | Q86WV1 |
◆ Recombinant Proteins | ||
Skap1-5893M | Recombinant Mouse Skap1 Protein, Myc/DDK-tagged | +Inquiry |
SKAP1-5471H | Recombinant Human SKAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Skap1-8109R | Recombinant Rat Skap1 protein, His & T7-tagged | +Inquiry |
SKAP1-5414R | Recombinant Rat SKAP1 Protein | +Inquiry |
SKAP1-4587H | Recombinant Human SKAP1 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SKAP1-1817HCL | Recombinant Human SKAP1 293 Cell Lysate | +Inquiry |
SKAP1-1818HCL | Recombinant Human SKAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SKAP1 Products
Required fields are marked with *
My Review for All SKAP1 Products
Required fields are marked with *