Recombinant Human SREBF2
Cat.No. : | SREBF2-31395TH |
Product Overview : | Recombinant fragment corresponding to amino acids 801-900 of Human SREBP2 with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a ubiquitously expressed transcription factor that controls cholesterol homeostasis by stimulating transcription of sterol-regulated genes. The encoded protein contains a basic helix-loop-helix-leucine zipper (bHLH-Zip) domain. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Ubiquitously expressed in adult and fetal tissues. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QAFCKNLLERAIESLVKPQAKKKAGDQEEESCEFSSALEYLKLLHSFVDSVGVMSPPLSRSSVLKSALGPDIICRWWTSAITVAISWLQGDDAAVRSHFT |
Sequence Similarities : | Belongs to the SREBP family.Contains 1 basic helix-loop-helix (bHLH) domain. |
Gene Name | SREBF2 sterol regulatory element binding transcription factor 2 [ Homo sapiens ] |
Official Symbol | SREBF2 |
Synonyms | SREBF2; sterol regulatory element binding transcription factor 2; sterol regulatory element-binding protein 2; bHLHd2; SREBP2; |
Gene ID | 6721 |
mRNA Refseq | NM_004599 |
Protein Refseq | NP_004590 |
MIM | 600481 |
Uniprot ID | Q12772 |
Chromosome Location | 22q13.2 |
Function | NOT C-8 sterol isomerase activity; chromatin binding; protein C-terminus binding; protein binding; sequence-specific DNA binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SREBF2 Products
Required fields are marked with *
My Review for All SREBF2 Products
Required fields are marked with *