Recombinant Human SREBF2

• Cat.No.: SREBF2-31395TH
• Product Overview: Recombinant fragment corresponding to amino acids 801-900 of Human SREBP2 with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene encodes a ubiquitously expressed transcription factor that controls cholesterol homeostasis by stimulating transcription of sterol-regulated genes. The encoded protein contains a basic helix-loop-helix-leucine zipper (bHLH-Zip) domain.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Ubiquitously expressed in adult and fetal tissues.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QAFCKNLLERAIESLVKPQAKKKAGDQEEESCEFSSALEYLKLLHSFVDSVGVMSPPLSRSSVLKSALGPDIICRWWTSAITVAISWLQGDDAAVRSHFT
• Sequence Similarities: Belongs to the SREBP family.Contains 1 basic helix-loop-helix (bHLH) domain.

Gene Information

• Gene Name: SREBF2 sterol regulatory element binding transcription factor 2 [ Homo sapiens ]
• Official Symbol: SREBF2
• Synonyms: SREBF2; sterol regulatory element binding transcription factor 2; sterol regulatory element-binding protein 2; bHLHd2; SREBP2
• Gene ID: 6721
• mRNA Refseq: NM_004599
• Protein Refseq: NP_004590
• MIM: 600481
• Uniprot ID: Q12772
• Chromosome Location: 22q13.2
• Function: NOT C-8 sterol isomerase activity; chromatin binding; protein C-terminus binding; protein binding; sequence-specific DNA binding