Recombinant Human SRNF2 protein, GST-tagged

• Cat.No.: RNF2-301640H
• Product Overview: Recombinant Human RNF2 (1-336 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Lys336
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: RNF2 ring finger protein 2 [ Homo sapiens ]
• Official Symbol: RNF2
• Synonyms: RNF2; ring finger protein 2; E3 ubiquitin-protein ligase RING2; BAP 1; BAP1; DING; HIPI3; RING1B; RING2; protein DinG; RING finger protein 1B; RING finger protein BAP-1; HIP2-interacting protein 3; huntingtin-interacting protein 2-interacting protein 3; BAP-1
• Gene ID: 6045
• mRNA Refseq: NM_007212
• Protein Refseq: NP_009143
• MIM: 608985
• UniProt ID: Q99496