Recombinant Human SRPRB Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SRPRB-1831H |
Product Overview : | SRPRB MS Standard C13 and N15-labeled recombinant protein (NP_067026) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane. |
Molecular Mass : | 29.7 kDa |
AA Sequence : | MASADSRRLADGGGAGGTFQPYLDTLRQELQQTDPTLLSVVVAVLAVLLTLVFWKLIRSRRSSQRAVLLVGLCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKIASGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SRPRB SRP receptor subunit beta [ Homo sapiens (human) ] |
Official Symbol | SRPRB |
Synonyms | SRPRB; SRP receptor subunit beta; APMCF1; SR-beta; signal recognition particle receptor subunit beta; SRP receptor beta subunit; signal recognition particle receptor, B subunit; signal recognition particle receptor, beta subunit |
Gene ID | 58477 |
mRNA Refseq | NM_021203 |
Protein Refseq | NP_067026 |
MIM | 616883 |
UniProt ID | Q9Y5M8 |
◆ Recombinant Proteins | ||
SRPRB-4288R | Recombinant Rhesus Macaque SRPRB Protein, His (Fc)-Avi-tagged | +Inquiry |
Srprb-6134M | Recombinant Mouse Srprb Protein, Myc/DDK-tagged | +Inquiry |
SRPRB-3430H | Recombinant Human SRPRB protein, His-tagged | +Inquiry |
RFL14630RF | Recombinant Full Length Rat Signal Recognition Particle Receptor Subunit Beta(Srprb) Protein, His-Tagged | +Inquiry |
SRPRB-691Z | Recombinant Zebrafish SRPRB | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRPRB-1473HCL | Recombinant Human SRPRB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRPRB Products
Required fields are marked with *
My Review for All SRPRB Products
Required fields are marked with *