Recombinant Human SRPRB Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SRPRB-1831H |
| Product Overview : | SRPRB MS Standard C13 and N15-labeled recombinant protein (NP_067026) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane. |
| Molecular Mass : | 29.7 kDa |
| AA Sequence : | MASADSRRLADGGGAGGTFQPYLDTLRQELQQTDPTLLSVVVAVLAVLLTLVFWKLIRSRRSSQRAVLLVGLCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKIASGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SRPRB SRP receptor subunit beta [ Homo sapiens (human) ] |
| Official Symbol | SRPRB |
| Synonyms | SRPRB; SRP receptor subunit beta; APMCF1; SR-beta; signal recognition particle receptor subunit beta; SRP receptor beta subunit; signal recognition particle receptor, B subunit; signal recognition particle receptor, beta subunit |
| Gene ID | 58477 |
| mRNA Refseq | NM_021203 |
| Protein Refseq | NP_067026 |
| MIM | 616883 |
| UniProt ID | Q9Y5M8 |
| ◆ Recombinant Proteins | ||
| Srprb-8127M | Recombinant Mouse Srprb protein, His & T7-tagged | +Inquiry |
| SRPRB-2257H | Recombinant Human SRPRB Protein, Flag-tagged | +Inquiry |
| SRPRB-15999M | Recombinant Mouse SRPRB Protein | +Inquiry |
| SRPRB-4472R | Recombinant Rhesus monkey SRPRB Protein, His-tagged | +Inquiry |
| RFL26352MF | Recombinant Full Length Mouse Signal Recognition Particle Receptor Subunit Beta(Srprb) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SRPRB-1473HCL | Recombinant Human SRPRB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRPRB Products
Required fields are marked with *
My Review for All SRPRB Products
Required fields are marked with *
