Recombinant Human SRPRB Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SRPRB-1831H
• Product Overview: SRPRB MS Standard C13 and N15-labeled recombinant protein (NP_067026) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.
• Molecular Mass: 29.7 kDa
• AA Sequence: MASADSRRLADGGGAGGTFQPYLDTLRQELQQTDPTLLSVVVAVLAVLLTLVFWKLIRSRRSSQRAVLLVGLCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKIASGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SRPRB SRP receptor subunit beta [ Homo sapiens (human) ]
• Official Symbol: SRPRB
• Synonyms: SRPRB; SRP receptor subunit beta; APMCF1; SR-beta; signal recognition particle receptor subunit beta; SRP receptor beta subunit; signal recognition particle receptor, B subunit; signal recognition particle receptor, beta subunit
• Gene ID: 58477
• mRNA Refseq: NM_021203
• Protein Refseq: NP_067026
• MIM: 616883
• UniProt ID: Q9Y5M8