Recombinant Full Length Human Signal Recognition Particle Receptor Subunit Beta(Srprb) Protein, His-Tagged
Cat.No. : | RFL32270HF |
Product Overview : | Recombinant Full Length Human Signal recognition particle receptor subunit beta(SRPRB) Protein (Q9Y5M8) (1-271aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-271) |
Form : | Lyophilized powder |
AA Sequence : | MASADSRRVADGGGAGGTFQPYLDTLRQELQQTDPTLLSVVVAVLAVLLTLVFWKLIRSR RSSQRAVLLVGLCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPG HESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACN KQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLK VEFLECSAKGGRGDVGSADIQDLEKWLAKIA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SRPRB |
Synonyms | SRPRB; PSEC0230; Signal recognition particle receptor subunit beta; SR-beta; Protein APMCF1 |
UniProt ID | Q9Y5M8 |
◆ Recombinant Proteins | ||
SRPRB-1831H | Recombinant Human SRPRB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SRPRB-5402R | Recombinant Rat SRPRB Protein, His (Fc)-Avi-tagged | +Inquiry |
SRPRB-8126H | Recombinant Human SRPRB protein, His & T7-tagged | +Inquiry |
SRPRB-4288R | Recombinant Rhesus Macaque SRPRB Protein, His (Fc)-Avi-tagged | +Inquiry |
Srprb-8127M | Recombinant Mouse Srprb protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRPRB-1473HCL | Recombinant Human SRPRB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRPRB Products
Required fields are marked with *
My Review for All SRPRB Products
Required fields are marked with *