Recombinant Human SRX1 protein, GST-tagged
Cat.No. : | SRX1-2962H |
Product Overview : | Recombinant Human SRX1 protein(1-137 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-137 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MGLRAGGTLGRAGAGRGAPEGPGPSGGAQGGSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIREDPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTLSDLRVYLGASTPDLQ |
Gene Name | SRXN1 sulfiredoxin 1 [ Homo sapiens ] |
Official Symbol | SRXN1 |
Synonyms | SRXN1; sulfiredoxin 1; C20orf139, chromosome 20 open reading frame 139 , sulfiredoxin 1 homolog (S. cerevisiae); sulfiredoxin-1; dJ850E9.2; Npn3; SRX1; YKL086W; sulfiredoxin 1 homolog; C20orf139; FLJ43353; |
Gene ID | 140809 |
mRNA Refseq | NM_080725 |
Protein Refseq | NP_542763 |
UniProt ID | Q9BYN0 |
◆ Recombinant Proteins | ||
RFL27496MF | Recombinant Full Length Mouse Atp-Binding Cassette Sub-Family G Member 8(Abcg8) Protein, His-Tagged | +Inquiry |
Abcg8-8151M | Recombinant Mouse Abcg8 protein, His & T7-tagged | +Inquiry |
ABCG8-6439Z | Recombinant Zebrafish ABCG8 | +Inquiry |
ABCG8-209M | Recombinant Mouse ABCG8 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABCG8-416R | Recombinant Rat ABCG8 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABCG8-9141HCL | Recombinant Human ABCG8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABCG8 Products
Required fields are marked with *
My Review for All ABCG8 Products
Required fields are marked with *
0
Inquiry Basket