Recombinant Human SRXN1 protein(1-137aa), His&Myc-tagged
| Cat.No. : | SRXN1-3928H |
| Product Overview : | Recombinant Human SRXN1 protein(Q9BYN0)(1-137aa), fused with N-terminal His and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-137aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 19.9 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MGLRAGGTLGRAGAGRGAPEGPGPSGGAQGGSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIREDPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQS |
| Gene Name | SRXN1 sulfiredoxin 1 [ Homo sapiens ] |
| Official Symbol | SRXN1 |
| Synonyms | SRXN1; sulfiredoxin 1; C20orf139, chromosome 20 open reading frame 139 , sulfiredoxin 1 homolog (S. cerevisiae); sulfiredoxin-1; dJ850E9.2; Npn3; SRX1; YKL086W; sulfiredoxin 1 homolog; C20orf139; FLJ43353; |
| Gene ID | 140809 |
| mRNA Refseq | NM_080725 |
| Protein Refseq | NP_542763 |
| UniProt ID | Q9BYN0 |
| ◆ Recombinant Proteins | ||
| SRXN1-4479R | Recombinant Rhesus monkey SRXN1 Protein, His-tagged | +Inquiry |
| SRXN1-3928H | Recombinant Human SRXN1 protein(1-137aa), His&Myc-tagged | +Inquiry |
| SRXN1-4295R | Recombinant Rhesus Macaque SRXN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SRXN1-7855H | Recombinant Human SRXN1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRXN1 Products
Required fields are marked with *
My Review for All SRXN1 Products
Required fields are marked with *
