Recombinant Human SRXN1 protein, His-tagged
Cat.No. : | SRXN1-7855H |
Product Overview : | Recombinant Human SRXN1 protein(1-137 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Tag : | His |
Protein Length : | 1-137 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MGLRAGGTLGRAGAGRGAPEGPGPSGGAQGGSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIREDPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTLSDLRVYLGASTPDLQ |
Gene Name | SRXN1 sulfiredoxin 1 [ Homo sapiens ] |
Official Symbol | SRXN1 |
Synonyms | SRXN1; sulfiredoxin 1; C20orf139, chromosome 20 open reading frame 139 , sulfiredoxin 1 homolog (S. cerevisiae); sulfiredoxin-1; dJ850E9.2; Npn3; SRX1; YKL086W; sulfiredoxin 1 homolog; C20orf139; FLJ43353; |
Gene ID | 140809 |
mRNA Refseq | NM_080725 |
Protein Refseq | NP_542763 |
UniProt ID | Q9BYN0 |
◆ Recombinant Proteins | ||
SRXN1-3928H | Recombinant Human SRXN1 protein(1-137aa), His&Myc-tagged | +Inquiry |
SRXN1-4479R | Recombinant Rhesus monkey SRXN1 Protein, His-tagged | +Inquiry |
SRXN1-7855H | Recombinant Human SRXN1 protein, His-tagged | +Inquiry |
SRXN1-4295R | Recombinant Rhesus Macaque SRXN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRXN1 Products
Required fields are marked with *
My Review for All SRXN1 Products
Required fields are marked with *
0
Inquiry Basket