Recombinant Human SSPN Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SSPN-5597H |
Product Overview : | SSPN MS Standard C13 and N15-labeled recombinant protein (NP_005077) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the dystrophin-glycoprotein complex (DGC). The DGC spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Two alternatively spliced transcript variants that encode different protein isoforms have been described. |
Molecular Mass : | 26.6 kDa |
AA Sequence : | MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVVGFLMASISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDERTCIQFSMKLLYFLLSALGLTVCVLAVAFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCLLACFVMWKHRYQVFYVGVRICSLTASEGPQQKITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SSPN sarcospan [ Homo sapiens (human) ] |
Official Symbol | SSPN |
Synonyms | SSPN; sarcospan; KRAG, Kras oncogene associated gene; SPN1; SPN2; nanospan; microspan; Kras oncogene-associated; kirsten-ras-associated protein; K-ras oncogene-associated protein; sarcospan (Kras oncogene-associated gene); KRAG; NSPN; DAGA5; |
Gene ID | 8082 |
mRNA Refseq | NM_005086 |
Protein Refseq | NP_005077 |
MIM | 601599 |
UniProt ID | Q14714 |
◆ Recombinant Proteins | ||
SSPN-5597H | Recombinant Human SSPN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SSPN-301424H | Recombinant Human SSPN protein, GST-tagged | +Inquiry |
SSPN-4488R | Recombinant Rhesus monkey SSPN Protein, His-tagged | +Inquiry |
SSPN-970HFL | Recombinant Full Length Human SSPN Protein, C-Flag-tagged | +Inquiry |
RFL13337MF | Recombinant Full Length Mouse Sarcospan(Sspn) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSPN-1697HCL | Recombinant Human SSPN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SSPN Products
Required fields are marked with *
My Review for All SSPN Products
Required fields are marked with *
0
Inquiry Basket