Recombinant Human SSX2 protein, GST-tagged
Cat.No. : | SSX2-301603H |
Product Overview : | Recombinant Human SSX2 (177-223 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
Source : | E. coli |
Species : | Human |
Tag : | GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Protein length : | Asn177-Trp223 |
AA Sequence : | NTHNIGRFSLSTSMGAVHGTPKTITHNRDPKGGNMPGPTDCVRENSW |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name : | SSX2 synovial sarcoma, X breakpoint 2 [ Homo sapiens ] |
Official Symbol : | SSX2 |
Synonyms : | SSX2; synovial sarcoma, X breakpoint 2; SSX; protein SSX2; cancer/testis antigen family 5; member 2a; CT5.2a; HD21; HOM MEL 40; MGC3884; MGC15364; MGC119055; sarcoma; synovial; X chromosome related 2; synovial sarcoma; X breakpoint 2; isoform b; X breakpoint 2B; CT5.2; tumor antigen HOM-MEL-40; cancer/testis antigen 5.2; synovial sarcoma, X breakpoint 2B; cancer/testis antigen family 5, member 2a; sarcoma, synovial, X-chromosome-related 2; synovial sarcoma, X breakpoint 2, isoform b; SSX2B; HOM-MEL-40; |
Gene ID : | 6757 |
mRNA Refseq : | NM_003147 |
Protein Refseq : | NP_003138 |
MIM : | 300192 |
UniProt ID : | Q16385 |
Products Types
◆ Recombinant Protein | ||
SSX2-2109H | Recombinant Human SSX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SSX2-301344H | Recombinant Human SSX2 protein, GST-tagged | +Inquiry |
SSX2-4017H | Recombinant Human SSX2 protein, His-tagged | +Inquiry |
SSX2-234H | Recombinant Human SSX2, His-tagged | +Inquiry |
SSX2-31172TH | Recombinant Human SSX2 | +Inquiry |
◆ Lysates | ||
SSX2-1449HCL | Recombinant Human SSX2 293 Cell Lysate | +Inquiry |
SSX2-1448HCL | Recombinant Human SSX2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket