Recombinant Full Length Human SSX2 Protein

• Cat.No.: SSX2-503HF
• Product Overview: Recombinant full length Human SSX2 isoform 2 with N terminal proprietary tag; Predicted MW 50.64 kDa.

Specification

• Description: The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. The encoded hybrid proteins are probably responsible for transforming activity. Two transcript variants encoding distinct isoforms have been identified for this gene.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 50.640kDa inclusive of tags
• Protein Length: 223 amino acids
• AA Sequence: MNGDDAFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKM KASEKIFYVYMKRKYEAMTKLGFKATLPPFMCNKRAEDFQ GNDLDNDPNRGNQVERPQMTFGRLQGISPKIMPKKPAEEG NDSEEVPEASGPQNDGKELCPPGKPTTSEKIHERSGNREA QEKEERRGTAHRWSSQNTHNIGRFSLSTSMGAVHGTPKTI THNRDPKGGNMPGPTDCVRENSW
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: SSX2 synovial sarcoma, X breakpoint 2 [ Homo sapiens ]
• Official Symbol: SSX2
• Synonyms: SSX2; synovial sarcoma, X breakpoint 2; SSX; protein SSX2; cancer/testis antigen family 5; member 2a; CT5.2a; HD21; HOM MEL 40; MGC3884; MGC15364; MGC119055; sarcoma; synovial; X chromosome related 2; synovial sarcoma; X breakpoint 2; isoform b; X breakpo
• Gene ID: 6757
• mRNA Refseq: NM_003147
• Protein Refseq: NP_003138
• MIM: 300192
• UniProt ID: Q16385