Recombinant Human SSX4 protein, His-tagged

• Cat.No.: SSX4-4543H
• Product Overview: Recombinant Human SSX4 protein(O60224)(1-188aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-188a.a.
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 25.9 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYMKLNYEVMTKLGFKVTLPPFMRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE

Gene Information

• Gene Name: SSX4 synovial sarcoma, X breakpoint 4 [ Homo sapiens ]
• Official Symbol: SSX4
• Synonyms: SSX4; synovial sarcoma, X breakpoint 4; protein SSX4; CT5.4; cancer/testis antigen 5.4; SSX4B; MGC12411; MGC119056
• Gene ID: 6759
• mRNA Refseq: NM_005636
• Protein Refseq: NP_005627
• MIM: 300326
• UniProt ID: O60224