Recombinant Human ST6GAL1 Full Length Transmembrane protein (1-406 aa), His-tagged
Cat.No. : | ST6GAL1-2720H |
Product Overview : | Recombinant Human ST6GAL1 Protein (1-406 aa) is produced by in vitro E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-406aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 52.1kDa |
AA Sequence : | MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 [ Homo sapiens ] |
Official Symbol | ST6GAL1 |
Synonyms | ST6GAL1; ST6 beta-galactosamide alpha-2,6-sialyltranferase 1; sialyltransferase 1 (beta galactoside alpha 2,6 sialytransferase) , SIAT1; beta-galactoside alpha-2,6-sialyltransferase 1; ST6Gal I; alpha 2,6-ST 1; B-cell antigen CD75; sialyltransferase 1 (beta-galactoside alpha-2,6-sialyltransferase); CMP-N-acetylneuraminate beta-galactosamide alpha-2,6-sialyltransferase; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1; ST6N; SIAT1; ST6GalI; MGC48859; |
Gene ID | 6480 |
mRNA Refseq | NM_003032 |
Protein Refseq | NP_003023 |
MIM | 109675 |
UniProt ID | P15907 |
◆ Cell & Tissue Lysates | ||
ST6GAL1-1919HCL | Recombinant Human ST6GAL1 cell lysate | +Inquiry |
ST6GAL1-1760MCL | Recombinant Mouse ST6GAL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ST6GAL1 Products
Required fields are marked with *
My Review for All ST6GAL1 Products
Required fields are marked with *