Recombinant Human ST8SIA1 Protein (AA 50-356), N-6×His/GFP tagged
Cat.No. : | ST8SIA1-19H |
Product Overview : | Recombinant Human ST8SIA1 Protein (AA 50-356) with N-6×His/GFP tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | GFP&His |
Protein Length : | AA 50-356 |
Description : | Gangliosides are membrane-bound glycosphingolipids containing sialic acid. Ganglioside GD3 is known to be important for cell adhesion and growth of cultured malignant cells. The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to GM3 to produce gangliosides GD3 and GT3. The encoded protein may be found in the Golgi apparatus and is a member of glycosyltransferase family 29. Alternatively spliced transcript variants have been found for this gene. |
Molecular Mass : | ~70 kDa |
AA Sequence : | RLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVAIYGFWPFSVNMHEQPISHHYYDNVLPFSGFHAMPEEFLQLWYLHKIGALRMQLDPCEDTSLQPTS |
Purity : | >95%, by SDS-PAGE as visualized by Coomassie Blue Staining |
Stability : | 6 months if stored at -80 centigrade. Avoid repeated freeze thaws. |
Concentration : | 1 mg/mL |
Storage Buffer : | Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol. |
Preservative : | 0.05 % NaN3 |
Shipping : | This product is shipped as 0.2μm filtered product on dry ice. |
Gene Name | ST8SIA1 ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 [ Homo sapiens (human) ] |
Official Symbol | ST8SIA1 |
Synonyms | ST8SIA1; ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1; sialyltransferase 8 (alpha N acetylneuraminate: alpha 2,8 sialytransferase, GD3 synthase) A , SIAT8, SIAT8A; alpha-N-acetylneuraminide alpha-2,8-sialyltransferase; ST8Sia I; ganglioside GD3 synthase; ganglioside GT3 synthase; sialytransferase St8Sia I; alpha-2,8-sialyltransferase 8A; disialoganglioside (GD3) synthase; ganglioside-specific alpha-2,8-polysialyltransferase; sialyltransferase 8 (alpha-N-acetylneuraminate: alpha-2,8-sialytransferase, GD3 synthase) A; sialyltransferase 8A (alpha-N-acetylneuraminate: alpha-2,8-sialyltransferase, GD3 synthase); GD3S; SIAT8; SIAT8A; SIAT8-A; ST8SiaI; |
Gene ID | 6489 |
mRNA Refseq | NM_003034 |
Protein Refseq | NP_003025 |
MIM | 601123 |
UniProt ID | Q92185 |
◆ Recombinant Proteins | ||
ST8SIA1-707H | Recombinant Human ST8SIA1 Protein, His-tagged | +Inquiry |
ST8SIA1-19H | Recombinant Human ST8SIA1 Protein (AA 50-356), N-6×His/GFP tagged | +Inquiry |
ST8SIA1-16078M | Recombinant Mouse ST8SIA1 Protein | +Inquiry |
ST8SIA1-30852TH | Recombinant Human ST8SIA1 | +Inquiry |
ST8SIA1-6292H | Recombinant Human ST8SIA1 Protein (Tyr49-Ser356), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ST8SIA1-1434HCL | Recombinant Human ST8SIA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ST8SIA1 Products
Required fields are marked with *
My Review for All ST8SIA1 Products
Required fields are marked with *