Recombinant Human STAC2 protein, His-tagged

• Cat.No.: STAC2-5643H
• Product Overview: Recombinant Human STAC2 protein(65-154 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 65-154 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: TLRYGTSLALMNRSSFSSTSESPTRSLSERDELTEDGEGSIRSSEEGPGDSASPVFTAPAESEGPGPEEKSPGQQLPKATLRKDVGPMYS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: STAC2 SH3 and cysteine rich domain 2 [ Homo sapiens ]
• Official Symbol: STAC2
• Synonyms: STAC2; SH3 and cysteine rich domain 2; SH3 and cysteine-rich domain-containing protein 2; 24b2; SRC homology 3 and cysteine-rich domain-containing protein 2; 24b2/STAC2; MGC129694
• Gene ID: 342667
• mRNA Refseq: NM_198993
• Protein Refseq: NP_945344
• UniProt ID: Q6ZMT1