Recombinant Human STAC2 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | STAC2-392H |
Product Overview : | STAC2 MS Standard C13 and N15-labeled recombinant protein (NP_945344) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein containing an SH3 domain and a zinc finger domain. The encoded protein has been shown to regulate calcium channel inactivation in a human cell line. Reduced expression of this gene has been observed in human heart failure. [provided by RefSeq, May 2017] |
Molecular Mass : | 44.8 kDa |
AA Sequence : | MTEMSEKENEPDDAATHSPPGTVSALQETKLQRFKRSLSLKTILRSKSLENFFLRSGSELKCPTEVLLTPPTPLPPPSPPPTASDRGLATPSPSPCPVPRPLAALKPVRLHSFQEHVFKRASPCELCHQLIVGNSKQGLRCKMCKVSVHLWCSEEISHQQCPGKTSTSFRRNFSSPLLVHEPPPVCATSKESPPTGDSGKVDPVYETLRYGTSLALMNRSSFSSTSESPTRSLSERDELTEDGEGSIRSSEEGPGDSASPVFTAPAESEGPGPEEKSPGQQLPKATLRKDVGPMYSYVALYKFLPQENNDLALQPGDRIMLVDDSNEDWWKGKIGDRVGFFPANFVQRVRPGENVWRCCQPFSGNKEQGYMSLKENQICVGVGRSKDADGFIRVSSGKKRGLVPVDALTEITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | STAC2 SH3 and cysteine rich domain 2 [ Homo sapiens (human) ] |
Official Symbol | STAC2 |
Synonyms | STAC2; SH3 and cysteine rich domain 2; SH3 and cysteine-rich domain-containing protein 2; 24b2; SRC homology 3 and cysteine-rich domain-containing protein 2; 24b2/STAC2; MGC129694; |
Gene ID | 342667 |
mRNA Refseq | NM_198993 |
Protein Refseq | NP_945344 |
UniProt ID | Q6ZMT1 |
◆ Recombinant Proteins | ||
STAC2-2849H | Recombinant Human STAC2 Protein, MYC/DDK-tagged | +Inquiry |
STAC2-392H | Recombinant Human STAC2 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
Stac2-6156M | Recombinant Mouse Stac2 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STAC2 Products
Required fields are marked with *
My Review for All STAC2 Products
Required fields are marked with *
0
Inquiry Basket