Recombinant Human STAC2 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: STAC2-392H
• Product Overview: STAC2 MS Standard C13 and N15-labeled recombinant protein (NP_945344) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a protein containing an SH3 domain and a zinc finger domain. The encoded protein has been shown to regulate calcium channel inactivation in a human cell line. Reduced expression of this gene has been observed in human heart failure. [provided by RefSeq, May 2017]
• Molecular Mass: 44.8 kDa
• AA Sequence: MTEMSEKENEPDDAATHSPPGTVSALQETKLQRFKRSLSLKTILRSKSLENFFLRSGSELKCPTEVLLTPPTPLPPPSPPPTASDRGLATPSPSPCPVPRPLAALKPVRLHSFQEHVFKRASPCELCHQLIVGNSKQGLRCKMCKVSVHLWCSEEISHQQCPGKTSTSFRRNFSSPLLVHEPPPVCATSKESPPTGDSGKVDPVYETLRYGTSLALMNRSSFSSTSESPTRSLSERDELTEDGEGSIRSSEEGPGDSASPVFTAPAESEGPGPEEKSPGQQLPKATLRKDVGPMYSYVALYKFLPQENNDLALQPGDRIMLVDDSNEDWWKGKIGDRVGFFPANFVQRVRPGENVWRCCQPFSGNKEQGYMSLKENQICVGVGRSKDADGFIRVSSGKKRGLVPVDALTEITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: STAC2 SH3 and cysteine rich domain 2 [ Homo sapiens (human) ]
• Official Symbol: STAC2
• Synonyms: STAC2; SH3 and cysteine rich domain 2; SH3 and cysteine-rich domain-containing protein 2; 24b2; SRC homology 3 and cysteine-rich domain-containing protein 2; 24b2/STAC2; MGC129694
• Gene ID: 342667
• mRNA Refseq: NM_198993
• Protein Refseq: NP_945344
• UniProt ID: Q6ZMT1