Recombinant Human STAC2 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : STAC2-392H
Product Overview : STAC2 MS Standard C13 and N15-labeled recombinant protein (NP_945344) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein containing an SH3 domain and a zinc finger domain. The encoded protein has been shown to regulate calcium channel inactivation in a human cell line. Reduced expression of this gene has been observed in human heart failure. [provided by RefSeq, May 2017]
Molecular Mass : 44.8 kDa
AA Sequence : MTEMSEKENEPDDAATHSPPGTVSALQETKLQRFKRSLSLKTILRSKSLENFFLRSGSELKCPTEVLLTPPTPLPPPSPPPTASDRGLATPSPSPCPVPRPLAALKPVRLHSFQEHVFKRASPCELCHQLIVGNSKQGLRCKMCKVSVHLWCSEEISHQQCPGKTSTSFRRNFSSPLLVHEPPPVCATSKESPPTGDSGKVDPVYETLRYGTSLALMNRSSFSSTSESPTRSLSERDELTEDGEGSIRSSEEGPGDSASPVFTAPAESEGPGPEEKSPGQQLPKATLRKDVGPMYSYVALYKFLPQENNDLALQPGDRIMLVDDSNEDWWKGKIGDRVGFFPANFVQRVRPGENVWRCCQPFSGNKEQGYMSLKENQICVGVGRSKDADGFIRVSSGKKRGLVPVDALTEITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name STAC2 SH3 and cysteine rich domain 2 [ Homo sapiens (human) ]
Official Symbol STAC2
Synonyms STAC2; SH3 and cysteine rich domain 2; SH3 and cysteine-rich domain-containing protein 2; 24b2; SRC homology 3 and cysteine-rich domain-containing protein 2; 24b2/STAC2; MGC129694;
Gene ID 342667
mRNA Refseq NM_198993
Protein Refseq NP_945344
UniProt ID Q6ZMT1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STAC2 Products

Required fields are marked with *

My Review for All STAC2 Products

Required fields are marked with *

0
cart-icon
0
compare icon