Recombinant Human STAP2 protein, GST-tagged
| Cat.No. : | STAP2-301495H |
| Product Overview : | Recombinant Human STAP2 (201-403 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Val201-His403 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | VRHYKVKREGPKYVIDVEQPFSCTSLDAVVNYFVSHTKKALVPFLLDEDYEKVLGYVEADKENGENVWVAPSAPGPGPAPCTGGPKPLSPASSQDKLPPLPPLPNQEENYVTPIGDGPAVDYENQDVASSSWPVILKPKKLPKPPAKLPKPPVGPKPEPKVFNGGLGRKLPVSSAQPLFPTAGLADMTAELQKKLEKRRALEH |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | STAP2 signal transducing adaptor family member 2 [ Homo sapiens ] |
| Official Symbol | STAP2 |
| Synonyms | STAP2; signal transducing adaptor family member 2; signal-transducing adaptor protein 2; BKS; STAP 2; BRK substrate; brk kinase substrate; breast tumor kinase substrate; signal-transducing adaptor protein-2; FLJ20234; |
| Gene ID | 55620 |
| mRNA Refseq | NM_001013841 |
| Protein Refseq | NP_001013863 |
| MIM | 607881 |
| UniProt ID | Q9UGK3 |
| ◆ Recombinant Proteins | ||
| Stap2-309M | Recombinant Mouse Stap2 Protein, MYC/DDK-tagged | +Inquiry |
| STAP2-16097M | Recombinant Mouse STAP2 Protein | +Inquiry |
| STAP2-8779M | Recombinant Mouse STAP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| STAP2-5637H | Recombinant Human STAP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| STAP2-301495H | Recombinant Human STAP2 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| STAP2-1424HCL | Recombinant Human STAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STAP2 Products
Required fields are marked with *
My Review for All STAP2 Products
Required fields are marked with *
