Recombinant Human STAP2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | STAP2-5637H |
Product Overview : | STAP2 MS Standard C13 and N15-labeled recombinant protein (NP_001013863) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes the substrate of breast tumor kinase, an Src-type non-receptor tyrosine kinase. The encoded protein possesses domains and several tyrosine phosphorylation sites characteristic of adaptor proteins that mediate the interactions linking proteins involved in signal transduction pathways. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 44.9 kDa |
AA Sequence : | MASALRPPRVPKPKGVLPSHYYESFLEKKGPCDRDYKKFWAGLQGLTIYFYNSNRDFQHVEKLNLGAFEKLTDEIPWGSSRDPGTHFSLILRNQEIKFKVETLECREMWKGFILTVVELRVPTDLTLLPGHLYMMSEVLAKEEARRALETPSCFLKVSRLEAQLLLERYPECGNLLLRPSGDGADGVSVTTRQMHNGTHVVRHYKVKREGPKYVIDVEQPFSCTSLDAVVNYFVSHTKKALVPFLLDEDYEKVLGYVEADKENGENVWVAPSAPGPGPAPCTGGPKPLSPASSQDKLPPLPPLPNQEENYVTPIGDGPAVDYENQDVASSSWPVILKPKKLPKPPAKLPKPPVGPKPEPKVFNGGLGRKLPVSSAQPLFPTAGLADMTAELQKKLEKRRALEHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | STAP2 signal transducing adaptor family member 2 [ Homo sapiens (human) ] |
Official Symbol | STAP2 |
Synonyms | STAP2; signal transducing adaptor family member 2; signal-transducing adaptor protein 2; BKS; STAP 2; BRK substrate; brk kinase substrate; breast tumor kinase substrate; signal-transducing adaptor protein-2; FLJ20234; |
Gene ID | 55620 |
mRNA Refseq | NM_001013841 |
Protein Refseq | NP_001013863 |
MIM | 607881 |
UniProt ID | Q9UGK3 |
◆ Recombinant Proteins | ||
STAP2-16097M | Recombinant Mouse STAP2 Protein | +Inquiry |
STAP2-301495H | Recombinant Human STAP2 protein, GST-tagged | +Inquiry |
STAP2-5637H | Recombinant Human STAP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
STAP2-8779M | Recombinant Mouse STAP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Stap2-309M | Recombinant Mouse Stap2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STAP2-1424HCL | Recombinant Human STAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STAP2 Products
Required fields are marked with *
My Review for All STAP2 Products
Required fields are marked with *