Recombinant Human STAP2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : STAP2-5637H
Product Overview : STAP2 MS Standard C13 and N15-labeled recombinant protein (NP_001013863) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes the substrate of breast tumor kinase, an Src-type non-receptor tyrosine kinase. The encoded protein possesses domains and several tyrosine phosphorylation sites characteristic of adaptor proteins that mediate the interactions linking proteins involved in signal transduction pathways. Alternative splicing results in multiple transcript variants.
Molecular Mass : 44.9 kDa
AA Sequence : MASALRPPRVPKPKGVLPSHYYESFLEKKGPCDRDYKKFWAGLQGLTIYFYNSNRDFQHVEKLNLGAFEKLTDEIPWGSSRDPGTHFSLILRNQEIKFKVETLECREMWKGFILTVVELRVPTDLTLLPGHLYMMSEVLAKEEARRALETPSCFLKVSRLEAQLLLERYPECGNLLLRPSGDGADGVSVTTRQMHNGTHVVRHYKVKREGPKYVIDVEQPFSCTSLDAVVNYFVSHTKKALVPFLLDEDYEKVLGYVEADKENGENVWVAPSAPGPGPAPCTGGPKPLSPASSQDKLPPLPPLPNQEENYVTPIGDGPAVDYENQDVASSSWPVILKPKKLPKPPAKLPKPPVGPKPEPKVFNGGLGRKLPVSSAQPLFPTAGLADMTAELQKKLEKRRALEHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name STAP2 signal transducing adaptor family member 2 [ Homo sapiens (human) ]
Official Symbol STAP2
Synonyms STAP2; signal transducing adaptor family member 2; signal-transducing adaptor protein 2; BKS; STAP 2; BRK substrate; brk kinase substrate; breast tumor kinase substrate; signal-transducing adaptor protein-2; FLJ20234;
Gene ID 55620
mRNA Refseq NM_001013841
Protein Refseq NP_001013863
MIM 607881
UniProt ID Q9UGK3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STAP2 Products

Required fields are marked with *

My Review for All STAP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon