Recombinant Human STAT3 protein, His-SUMO-tagged
Cat.No. : | STAT3-3533H |
Product Overview : | Recombinant Human STAT3 protein(P40763)(50-240aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 50-240aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 38.3 kDa |
AA Sequence : | ESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) [ Homo sapiens ] |
Official Symbol | STAT3 |
Synonyms | STAT3; signal transducer and activator of transcription 3 (acute-phase response factor); signal transducer and activator of transcription 3; APRF; DNA-binding protein APRF; acute-phase response factor; HIES; FLJ20882; MGC16063; |
Gene ID | 6774 |
mRNA Refseq | NM_003150 |
Protein Refseq | NP_003141 |
MIM | 102582 |
UniProt ID | P40763 |
◆ Recombinant Proteins | ||
STAT3-4574HFL | Recombinant Full Length Human STAT3, Flag-tagged | +Inquiry |
STAT3-9038Z | Recombinant Zebrafish STAT3 | +Inquiry |
STAT3-507HF | Recombinant Full Length Human STAT3 Protein, GST-tagged | +Inquiry |
STAT3-674H | Recombinant Human STAT3 protein, His-tagged | +Inquiry |
STAT3-2172H | Recombinant Human STAT3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
STAT3-1417HCL | Recombinant Human STAT3 293 Cell Lysate | +Inquiry |
STAT3-1418HCL | Recombinant Human STAT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STAT3 Products
Required fields are marked with *
My Review for All STAT3 Products
Required fields are marked with *
0
Inquiry Basket