Recombinant Human STAT3 protein, His-SUMO-tagged
| Cat.No. : | STAT3-3533H |
| Product Overview : | Recombinant Human STAT3 protein(P40763)(50-240aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 50-240aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 38.3 kDa |
| AA Sequence : | ESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) [ Homo sapiens ] |
| Official Symbol | STAT3 |
| Synonyms | STAT3; signal transducer and activator of transcription 3 (acute-phase response factor); signal transducer and activator of transcription 3; APRF; DNA-binding protein APRF; acute-phase response factor; HIES; FLJ20882; MGC16063; |
| Gene ID | 6774 |
| mRNA Refseq | NM_003150 |
| Protein Refseq | NP_003141 |
| MIM | 102582 |
| UniProt ID | P40763 |
| ◆ Recombinant Proteins | ||
| STAT3-507HF | Recombinant Full Length Human STAT3 Protein, GST-tagged | +Inquiry |
| STAT3-153H | Recombinant Human STAT3 Protein, DYKDDDDK-tagged | +Inquiry |
| STAT3-10HFL | Recombinant Full Length Human signal transducer and activator of transcription 3 Protein, His tagged | +Inquiry |
| STAT3-2620C | Recombinant Chicken STAT3 | +Inquiry |
| STAT3-2837H | Recombinant Human STAT3 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| STAT3-1417HCL | Recombinant Human STAT3 293 Cell Lysate | +Inquiry |
| STAT3-301HKCL | Human STAT3 Knockdown Cell Lysate | +Inquiry |
| STAT3-1418HCL | Recombinant Human STAT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STAT3 Products
Required fields are marked with *
My Review for All STAT3 Products
Required fields are marked with *
