"STAT3" Related Products

Expand
Expand
Expand

Recombinant Human STAT3 protein, His-tagged

Cat.No.: STAT3-30H
Product Overview: Recombinant Human STAT3, transcript variant 2, fused with His tag at C-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag : His
Form: Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
Molecular Mass: 21.8kD
AA Sequence: MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNLEHHHHHH
Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name: STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) [ Homo sapiens ]
Official Symbol: STAT3
Synonyms: STAT3; signal transducer and activator of transcription 3 (acute-phase response factor); signal transducer and activator of transcription 3; APRF; DNA-binding protein APRF; acute-phase response factor; HIES; FLJ20882; MGC16063;
Gene ID: 6774
mRNA Refseq: NM_003150
Protein Refseq: NP_003141
MIM: 102582
UniProt ID: P40763
Chromosome Location: 17q21
Pathway: Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Adipogenesis, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem;
Function: CCR5 chemokine receptor binding; DNA binding; calcium ion binding; glucocorticoid receptor binding; ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity; non-membrane spanning protein tyrosine kinase activity; protein binding; protein dimerization activity; protein kinase binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; signal transducer activity; transcription factor binding; transcription regulatory region DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.