Recombinant Human STAT6, His-tagged

Cat.No. : STAT6-30854TH
Product Overview : Recombinant fragment, corresponding to amino acids 1-287 of Human STAT6 with N terminal His tag; 287 amino acids, 33kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-287 a.a.
Description : The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins. Alternative splicing results in multiple transcript variants.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 147 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWE FLVGSDAFCCNLASALLSDTVQHLQASVGEQGEGSTIL QHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRH LPMPFHWKQEELKFKTGLRRLQHRVGEIHLLREALQKGAE AGQVSLHSLIETPANGTGPSEALAMLLQETTGELEAAK ALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERCESLV DIYSQLQQEVGAAGGELEPKTRASLTGRLDEVLRTLVT SCFLVEKQPPQVLKTQT
Sequence Similarities : Belongs to the transcription factor STAT family.Contains 1 SH2 domain.
Gene Name STAT6 signal transducer and activator of transcription 6, interleukin-4 induced [ Homo sapiens ]
Official Symbol STAT6
Synonyms STAT6; signal transducer and activator of transcription 6, interleukin-4 induced; signal transducer and activator of transcription 6; D12S1644; IL 4 STAT;
Gene ID 6778
mRNA Refseq NM_001178078
Protein Refseq NP_001171549
MIM 601512
Uniprot ID P42226
Chromosome Location 12q13
Pathway Adipogenesis, organism-specific biosystem; Downstream signal transduction, organism-specific biosystem; IL-3 Signaling Pathway, organism-specific biosystem; IL-4 signaling Pathway, organism-specific biosystem; IL12-mediated signaling events, organism-specific biosystem;
Function calcium ion binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STAT6 Products

Required fields are marked with *

My Review for All STAT6 Products

Required fields are marked with *

0
cart-icon