Recombinant Human STAT6 Protein, His-tagged
Cat.No. : | STAT6-707H |
Product Overview : | Recombinant Human STAT6, transcript variant 2, fused with His tag at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins. Alternative splicing results in multiple transcript variants. |
Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Molecular Mass : | 23.9kD |
AA Sequence : | MSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSLEHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | STAT6 signal transducer and activator of transcription 6, interleukin-4 induced [ Homo sapiens ] |
Official Symbol | STAT6 |
Synonyms | STAT6; signal transducer and activator of transcription 6, interleukin-4 induced; signal transducer and activator of transcription 6; D12S1644; IL 4 STAT; STAT, interleukin4-induced; transcription factor IL-4 STAT; STAT6B; STAT6C; IL-4-STAT; |
Gene ID | 6778 |
mRNA Refseq | NM_001178078 |
Protein Refseq | NP_001171549 |
MIM | 601512 |
UniProt ID | P42226 |
◆ Recombinant Proteins | ||
STAT6-2916H | Recombinant Human STAT6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
STAT6-01M | Recombinant Mouse STAT6 Protein, His-tagged | +Inquiry |
STAT6-7074Z | Recombinant Zebrafish STAT6 | +Inquiry |
STAT6-344H | Recombinant Human STAT6 protein, His/MBP-tagged | +Inquiry |
Stat6-4312R | Recombinant Rat Stat6 Protein (Gly557-Trp841), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STAT6-481HCL | Recombinant Human STAT6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STAT6 Products
Required fields are marked with *
My Review for All STAT6 Products
Required fields are marked with *
0
Inquiry Basket