Recombinant Human STAT6 Protein, His-tagged

• Cat.No.: STAT6-707H
• Product Overview: Recombinant Human STAT6, transcript variant 2, fused with His tag at C-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins. Alternative splicing results in multiple transcript variants.
• Form: Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
• Molecular Mass: 23.9kD
• AA Sequence: MSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSLEHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: STAT6 signal transducer and activator of transcription 6, interleukin-4 induced [ Homo sapiens ]
• Official Symbol: STAT6
• Synonyms: STAT6; signal transducer and activator of transcription 6, interleukin-4 induced; signal transducer and activator of transcription 6; D12S1644; IL 4 STAT; STAT, interleukin4-induced; transcription factor IL-4 STAT; STAT6B; STAT6C; IL-4-STAT
• Gene ID: 6778
• mRNA Refseq: NM_001178078
• Protein Refseq: NP_001171549
• MIM: 601512
• UniProt ID: P42226