Recombinant Human STEAP1 Full Length Transmembrane protein, His-SUMO-tagged
| Cat.No. : | STEAP1-2472H |
| Product Overview : | Recombinant Human STEAP1 protein(Q9UHE8)(1-339aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-339aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 58.4kDa |
| AA Sequence : | MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | STEAP1 six transmembrane epithelial antigen of the prostate 1 [ Homo sapiens ] |
| Official Symbol | STEAP1 |
| Synonyms | STEAP1; six transmembrane epithelial antigen of the prostate 1; six transmembrane epithelial antigen of the prostate , STEAP; metalloreductase STEAP1; PRSS24; six-transmembrane epithelial antigen of prostate 1; STEAP; MGC19484; |
| Gene ID | 26872 |
| mRNA Refseq | NM_012449 |
| Protein Refseq | NP_036581 |
| MIM | 604415 |
| UniProt ID | Q9UHE8 |
| ◆ Cell & Tissue Lysates | ||
| STEAP1-1710HCL | Recombinant Human STEAP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STEAP1 Products
Required fields are marked with *
My Review for All STEAP1 Products
Required fields are marked with *



