Recombinant Human STEAP1 Full Length Transmembrane protein, His-SUMO-tagged
Cat.No. : | STEAP1-2472H |
Product Overview : | Recombinant Human STEAP1 protein(Q9UHE8)(1-339aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-339aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 58.4kDa |
AA Sequence : | MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | STEAP1 six transmembrane epithelial antigen of the prostate 1 [ Homo sapiens ] |
Official Symbol | STEAP1 |
Synonyms | STEAP1; six transmembrane epithelial antigen of the prostate 1; six transmembrane epithelial antigen of the prostate , STEAP; metalloreductase STEAP1; PRSS24; six-transmembrane epithelial antigen of prostate 1; STEAP; MGC19484; |
Gene ID | 26872 |
mRNA Refseq | NM_012449 |
Protein Refseq | NP_036581 |
MIM | 604415 |
UniProt ID | Q9UHE8 |
◆ Recombinant Proteins | ||
STEAP1-2472H | Recombinant Human STEAP1 Full Length Transmembrane protein, His-SUMO-tagged | +Inquiry |
STEAP1-574H | Active Recombinant Human STEAP1 protein, His-tagged(Detergent) | +Inquiry |
STEAP1-297H | Active Recombinant Human STEAP1 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
STEAP1-5801H | Recombinant Human STEAP1 Protein (Met1-His72), N-GST tagged | +Inquiry |
STEAP1-5281H | Recombinant Human STEAP1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STEAP1-1710HCL | Recombinant Human STEAP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STEAP1 Products
Required fields are marked with *
My Review for All STEAP1 Products
Required fields are marked with *
0
Inquiry Basket