Recombinant Human STIP1 protein(191-290 aa), C-His-tagged

• Cat.No.: STIP1-2723H
• Product Overview: Recombinant Human STIP1 protein(P31948)(191-290 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 191-290 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: DEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGR

Gene Information

• Gene Name: STIP1 stress-induced-phosphoprotein 1 [ Homo sapiens ]
• Official Symbol: STIP1
• Synonyms: STIP1; stress-induced-phosphoprotein 1; HOP; Hsp70/Hsp90 organizing protein; STI1; NY-REN-11 antigen; Hsp70/Hsp90-organizing protein; hsc70/Hsp90-organizing protein; renal carcinoma antigen NY-REN-11; transformation-sensitive protein IEF SSP 3521; P60; STI1L; IEF-SSP-3521
• Gene ID: 10963
• mRNA Refseq: NM_006819
• Protein Refseq: NP_006810
• MIM: 605063
• UniProt ID: P31948