Recombinant Human STIP1 protein(191-290 aa), C-His-tagged

Cat.No. : STIP1-2723H
Product Overview : Recombinant Human STIP1 protein(P31948)(191-290 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 191-290 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : DEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGR
Gene Name STIP1 stress-induced-phosphoprotein 1 [ Homo sapiens ]
Official Symbol STIP1
Synonyms STIP1; stress-induced-phosphoprotein 1; HOP; Hsp70/Hsp90 organizing protein; STI1; NY-REN-11 antigen; Hsp70/Hsp90-organizing protein; hsc70/Hsp90-organizing protein; renal carcinoma antigen NY-REN-11; transformation-sensitive protein IEF SSP 3521; P60; STI1L; IEF-SSP-3521;
Gene ID 10963
mRNA Refseq NM_006819
Protein Refseq NP_006810
MIM 605063
UniProt ID P31948

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STIP1 Products

Required fields are marked with *

My Review for All STIP1 Products

Required fields are marked with *

0
cart-icon