Recombinant Human STK25 protein, GST-tagged

• Cat.No.: STK25-301207H
• Product Overview: Recombinant Human STK25 protein(323-426 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 323-426 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: PTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRSQCLSTLVRPVFGELKEKHEQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRNHLTSTR
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: STK25 serine/threonine kinase 25 [ Homo sapiens ]
• Official Symbol: STK25
• Synonyms: STK25; serine/threonine kinase 25; serine/threonine kinase 25 (Ste20, yeast homolog); serine/threonine-protein kinase 25; SOK1; YSK1; SOK-1; ste20-like kinase; Ste20, yeast homolog; ste20/oxidant stress response kinase 1; sterile 20/oxidant stress-response kinase 1; serine/threonine kinase 25 (STE20 homolog, yeast); sterile 20 (oxidant stress response kinase 1; yeast Sps1/Ste20-related kinase 1); DKFZp686J1430
• Gene ID: 10494
• mRNA Refseq: NM_006374
• Protein Refseq: NP_006365
• MIM: 602255
• UniProt ID: O00506