Recombinant Human STK25 protein, GST-tagged

Cat.No. : STK25-301207H
Product Overview : Recombinant Human STK25 (323-426 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Pro323-Arg426
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : PTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRSQCLSTLVRPVFGELKEKHEQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRNHLTSTR
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name STK25 serine/threonine kinase 25 [ Homo sapiens ]
Official Symbol STK25
Synonyms STK25; serine/threonine kinase 25; serine/threonine kinase 25 (Ste20, yeast homolog); serine/threonine-protein kinase 25; SOK1; YSK1; SOK-1; ste20-like kinase; Ste20, yeast homolog; ste20/oxidant stress response kinase 1; sterile 20/oxidant stress-response kinase 1; serine/threonine kinase 25 (STE20 homolog, yeast); sterile 20 (oxidant stress response kinase 1; yeast Sps1/Ste20-related kinase 1); DKFZp686J1430;
Gene ID 10494
mRNA Refseq NM_006374
Protein Refseq NP_006365
MIM 602255
UniProt ID O00506

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STK25 Products

Required fields are marked with *

My Review for All STK25 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon