Recombinant Human STK25 protein, GST-tagged

Cat.No. : STK25-301207H
Product Overview : Recombinant Human STK25 protein(323-426 aa), fused with N-terminal GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 323-426 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : PTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRSQCLSTLVRPVFGELKEKHEQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRNHLTSTR
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name STK25 serine/threonine kinase 25 [ Homo sapiens ]
Official Symbol STK25
Synonyms STK25; serine/threonine kinase 25; serine/threonine kinase 25 (Ste20, yeast homolog); serine/threonine-protein kinase 25; SOK1; YSK1; SOK-1; ste20-like kinase; Ste20, yeast homolog; ste20/oxidant stress response kinase 1; sterile 20/oxidant stress-response kinase 1; serine/threonine kinase 25 (STE20 homolog, yeast); sterile 20 (oxidant stress response kinase 1; yeast Sps1/Ste20-related kinase 1); DKFZp686J1430;
Gene ID 10494
mRNA Refseq NM_006374
Protein Refseq NP_006365
MIM 602255
UniProt ID O00506

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STK25 Products

Required fields are marked with *

My Review for All STK25 Products

Required fields are marked with *

0
cart-icon
0
compare icon