Recombinant Human STK25 protein, GST-tagged
| Cat.No. : | STK25-301207H |
| Product Overview : | Recombinant Human STK25 protein(323-426 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 323-426 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | PTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRSQCLSTLVRPVFGELKEKHEQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRNHLTSTR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | STK25 serine/threonine kinase 25 [ Homo sapiens ] |
| Official Symbol | STK25 |
| Synonyms | STK25; serine/threonine kinase 25; serine/threonine kinase 25 (Ste20, yeast homolog); serine/threonine-protein kinase 25; SOK1; YSK1; SOK-1; ste20-like kinase; Ste20, yeast homolog; ste20/oxidant stress response kinase 1; sterile 20/oxidant stress-response kinase 1; serine/threonine kinase 25 (STE20 homolog, yeast); sterile 20 (oxidant stress response kinase 1; yeast Sps1/Ste20-related kinase 1); DKFZp686J1430; |
| Gene ID | 10494 |
| mRNA Refseq | NM_006374 |
| Protein Refseq | NP_006365 |
| MIM | 602255 |
| UniProt ID | O00506 |
| ◆ Recombinant Proteins | ||
| STK25-821H | Recombinant Human STK25 Protein (1-426 aa), His-SUMO-tagged | +Inquiry |
| STK25-567H | Recombinant Human STK25 Protein, GST-His-tagged | +Inquiry |
| Stk25-6186M | Recombinant Mouse Stk25 Protein, Myc/DDK-tagged | +Inquiry |
| STK25-5944C | Recombinant Chicken STK25 | +Inquiry |
| STK25-2112HFL | Recombinant Full Length Human STK25 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| STK25-1406HCL | Recombinant Human STK25 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STK25 Products
Required fields are marked with *
My Review for All STK25 Products
Required fields are marked with *



