Recombinant Human STRADA Protein, GST-tagged

Cat.No. : STRADA-4560H
Product Overview : Human LYK5 full-length ORF ( NP_699166.2, 1 a.a. - 348 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene contains a STE20-like kinase domain, but lacks several residues that are critical for catalytic activity, so it is termed a pseudokinase. The protein forms a heterotrimeric complex with serine/threonine kinase 11 (STK11, also known as LKB1) and the scaffolding protein calcium binding protein 39 (CAB39, also known as MO25). The protein activates STK11 leading to the phosphorylation of both proteins and excluding STK11 from the nucleus. The protein is necessary for STK11-induced G1 cell cycle arrest. A mutation in this gene has been shown to result in polyhydramnios, megalencephaly, and symptomatic epilepsy (PMSE) syndrome. Multiple transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been described but their full-length nature is not known. [provided by RefSeq
Molecular Mass : 65 kDa
AA Sequence : MSFLTNDASSESIASFSKQEVMSSFLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFKDMPATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQRNPDARYPCWPGPGLRESRGCSGG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name STRADA STE20-related kinase adaptor alpha [ Homo sapiens ]
Official Symbol STRADA
Synonyms STRADA; STE20-related kinase adaptor alpha; STE20-related kinase adapter protein alpha; LYK5; NY BR 96; STE20 like pseudokinase; Stlk; STRAD; STRAD alpha; protein kinase LYK5; STE20-like pseudokinase; serologically defined breast cancer antigen NY-BR-96; PMSE; NY-BR-96; FLJ90524;
Gene ID 92335
mRNA Refseq NM_001003786
Protein Refseq NP_001003786
MIM 608626
UniProt ID Q7RTN6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STRADA Products

Required fields are marked with *

My Review for All STRADA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon