Recombinant Human STRADA Protein, GST-tagged
Cat.No. : | STRADA-4560H |
Product Overview : | Human LYK5 full-length ORF ( NP_699166.2, 1 a.a. - 348 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene contains a STE20-like kinase domain, but lacks several residues that are critical for catalytic activity, so it is termed a pseudokinase. The protein forms a heterotrimeric complex with serine/threonine kinase 11 (STK11, also known as LKB1) and the scaffolding protein calcium binding protein 39 (CAB39, also known as MO25). The protein activates STK11 leading to the phosphorylation of both proteins and excluding STK11 from the nucleus. The protein is necessary for STK11-induced G1 cell cycle arrest. A mutation in this gene has been shown to result in polyhydramnios, megalencephaly, and symptomatic epilepsy (PMSE) syndrome. Multiple transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been described but their full-length nature is not known. [provided by RefSeq |
Molecular Mass : | 65 kDa |
AA Sequence : | MSFLTNDASSESIASFSKQEVMSSFLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFKDMPATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQRNPDARYPCWPGPGLRESRGCSGG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | STRADA STE20-related kinase adaptor alpha [ Homo sapiens ] |
Official Symbol | STRADA |
Synonyms | STRADA; STE20-related kinase adaptor alpha; STE20-related kinase adapter protein alpha; LYK5; NY BR 96; STE20 like pseudokinase; Stlk; STRAD; STRAD alpha; protein kinase LYK5; STE20-like pseudokinase; serologically defined breast cancer antigen NY-BR-96; PMSE; NY-BR-96; FLJ90524; |
Gene ID | 92335 |
mRNA Refseq | NM_001003786 |
Protein Refseq | NP_001003786 |
MIM | 608626 |
UniProt ID | Q7RTN6 |
◆ Recombinant Proteins | ||
STRADA-5463R | Recombinant Rat STRADA Protein, His (Fc)-Avi-tagged | +Inquiry |
STRADA-6235HF | Recombinant Full Length Human STRADA Protein, GST-tagged | +Inquiry |
STRADA-229H | Recombinant Human STRADA, His-tagged | +Inquiry |
STRADA-5804R | Recombinant Rat STRADA Protein | +Inquiry |
STRADA-4560H | Recombinant Human STRADA Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STRADA-1041HCL | Recombinant Human STRADA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STRADA Products
Required fields are marked with *
My Review for All STRADA Products
Required fields are marked with *
0
Inquiry Basket