Recombinant human SULT1A3 protein, GST-tagged

Cat.No. : SULT1A3-3545h
Product Overview : Recombinant human SULT1A3 protein(P0DMM9)(1-295aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : human
Source : E.coli
Tag : GST
Protein Length : 1-295aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 61.2 kDa
AA Sequence : MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name SULT1A3 sulfotransferase family, cytosolic, 1A, phenol-preferring, member 3 [ Homo sapiens ]
Official Symbol SULT1A3
Synonyms SULT1A3; sulfotransferase family, cytosolic, 1A, phenol-preferring, member 3; STM; sulfotransferase 1A3/1A4; TL PST; sulfokinase; phenol sulfotransferase 1A5; aryl sulfotransferase 1A3/1A4; dopamine-specific sulfotransferase; placental estrogen sulfotransferase; monoamine-sulfating phenosulfotransferase; catecholamine-sulfating phenol sulfotransferase; thermolabile (monoamine, M form) phenol sulfotransferase; HAST; HAST3; M-PST; ST1A5; TL-PST; ST1A3/ST1A4; MGC117469;
Gene ID 6818
mRNA Refseq NM_177552
Protein Refseq NP_808220
MIM 600641
UniProt ID P50224

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SULT1A3 Products

Required fields are marked with *

My Review for All SULT1A3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon